SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16761574|ref|NP_457191.1| from Salmonella enterica subsp. enterica serovar Typhi str. CT18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16761574|ref|NP_457191.1|
Domain Number 1 Region: 20-423
Classification Level Classification E-value
Superfamily PLP-dependent transferases 9.84e-134
Family GABA-aminotransferase-like 0.00000000000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16761574|ref|NP_457191.1|
Sequence length 427
Comment 4-aminobutyrate aminotransferase [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
Sequence
MNTNNTLMQRCHNAVPRGVGQIHPIFAERAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
GIVSAVEAQLKKLSHTCFQVLAYEPYLALCERMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGAIAFSGAYHGRTHYTLSLTGKVHPYSAGMGLMPGHVYRALYPCPLHNISD
DDAIASIERIFKNDAAPEDIAAIIIEPVQGEGGFYAASPAFMQRLRALCDQHGIMLIADE
VQSGAGRTGTLFAMEQMGVAADITTFAKSIAGGFPLAGVTGRADVMDAIAPGGLGGTYAG
NPIACVAALAVLDIFEQENLLQKANTLGKTLRDGLMEIAETHREIGDVRGLGAMIAIELF
ENGDPGKPNATLTADIVARAREKGLILLSCGPYYNILRILVPLTIEASQIRQGLEIIAQC
FDEAKQA
Download sequence
Identical sequences Q8Z4F7
gi|488655170|ref|YP_007926973.1| gi|16761574|ref|NP_457191.1| AE014613|CDS_2780349-2781632 AL513382|CDS_2794492-2795775 gi|378960853|ref|YP_005218339.1| NP_457191.1.84458 WP_001095643.1.100008 WP_001095643.1.100036 WP_001095643.1.100079 WP_001095643.1.100196 WP_001095643.1.100284 WP_001095643.1.100313 WP_001095643.1.100314 WP_001095643.1.100321 WP_001095643.1.100354 WP_001095643.1.100421 WP_001095643.1.100446 WP_001095643.1.100450 WP_001095643.1.100592 WP_001095643.1.100610 WP_001095643.1.100732 WP_001095643.1.100733 WP_001095643.1.100739 WP_001095643.1.100764 WP_001095643.1.100799 WP_001095643.1.100941 WP_001095643.1.100953 WP_001095643.1.101011 WP_001095643.1.10108 WP_001095643.1.101226 WP_001095643.1.10124 WP_001095643.1.101271 WP_001095643.1.101312 WP_001095643.1.101322 WP_001095643.1.101374 WP_001095643.1.101616 WP_001095643.1.101890 WP_001095643.1.101941 WP_001095643.1.102050 WP_001095643.1.102087 WP_001095643.1.10338 WP_001095643.1.1038 WP_001095643.1.104 WP_001095643.1.10401 WP_001095643.1.10428 WP_001095643.1.10459 WP_001095643.1.10475 WP_001095643.1.10511 WP_001095643.1.10514 WP_001095643.1.10530 WP_001095643.1.10532 WP_001095643.1.10547 WP_001095643.1.10595 WP_001095643.1.10642 WP_001095643.1.10654 WP_001095643.1.10677 WP_001095643.1.10857 WP_001095643.1.10873 WP_001095643.1.10926 WP_001095643.1.10936 WP_001095643.1.11012 WP_001095643.1.11055 WP_001095643.1.11126 WP_001095643.1.11142 WP_001095643.1.11239 WP_001095643.1.11253 WP_001095643.1.11314 WP_001095643.1.11385 WP_001095643.1.1142 WP_001095643.1.11426 WP_001095643.1.11429 WP_001095643.1.11557 WP_001095643.1.11567 WP_001095643.1.11638 WP_001095643.1.11883 WP_001095643.1.11908 WP_001095643.1.11914 WP_001095643.1.12040 WP_001095643.1.12061 WP_001095643.1.1207 WP_001095643.1.12141 WP_001095643.1.12172 WP_001095643.1.12192 WP_001095643.1.1224 WP_001095643.1.12364 WP_001095643.1.12398 WP_001095643.1.12441 WP_001095643.1.12581 WP_001095643.1.12620 WP_001095643.1.12648 WP_001095643.1.12683 WP_001095643.1.12726 WP_001095643.1.12727 WP_001095643.1.12741 WP_001095643.1.12834 WP_001095643.1.13108 WP_001095643.1.13161 WP_001095643.1.1321 WP_001095643.1.13268 WP_001095643.1.13291 WP_001095643.1.133 WP_001095643.1.13314 WP_001095643.1.13338 WP_001095643.1.13342 WP_001095643.1.13352 WP_001095643.1.13406 WP_001095643.1.13440 WP_001095643.1.13443 WP_001095643.1.13476 WP_001095643.1.13599 WP_001095643.1.13686 WP_001095643.1.1372 WP_001095643.1.13732 WP_001095643.1.1382 WP_001095643.1.1397 WP_001095643.1.13972 WP_001095643.1.140 WP_001095643.1.1401 WP_001095643.1.1408 WP_001095643.1.14089 WP_001095643.1.14099 WP_001095643.1.14120 WP_001095643.1.14123 WP_001095643.1.14150 WP_001095643.1.14191 WP_001095643.1.14197 WP_001095643.1.14280 WP_001095643.1.14333 WP_001095643.1.14399 WP_001095643.1.14444 WP_001095643.1.14467 WP_001095643.1.14474 WP_001095643.1.14500 WP_001095643.1.14526 WP_001095643.1.14550 WP_001095643.1.14575 WP_001095643.1.14701 WP_001095643.1.14703 WP_001095643.1.14719 WP_001095643.1.1473 WP_001095643.1.14765 WP_001095643.1.14810 WP_001095643.1.14877 WP_001095643.1.14894 WP_001095643.1.14930 WP_001095643.1.14947 WP_001095643.1.14948 WP_001095643.1.15184 WP_001095643.1.15244 WP_001095643.1.15265 WP_001095643.1.15362 WP_001095643.1.15415 WP_001095643.1.15423 WP_001095643.1.15433 WP_001095643.1.15439 WP_001095643.1.15487 WP_001095643.1.15535 WP_001095643.1.15581 WP_001095643.1.15597 WP_001095643.1.15710 WP_001095643.1.15717 WP_001095643.1.15905 WP_001095643.1.15912 WP_001095643.1.15970 WP_001095643.1.16046 WP_001095643.1.16051 WP_001095643.1.16058 WP_001095643.1.16150 WP_001095643.1.16155 WP_001095643.1.1626 WP_001095643.1.16264 WP_001095643.1.16344 WP_001095643.1.16452 WP_001095643.1.16461 WP_001095643.1.16462 WP_001095643.1.16465 WP_001095643.1.16522 WP_001095643.1.16588 WP_001095643.1.16658 WP_001095643.1.16666 WP_001095643.1.16673 WP_001095643.1.1674 WP_001095643.1.16767 WP_001095643.1.16781 WP_001095643.1.16879 WP_001095643.1.16893 WP_001095643.1.16905 WP_001095643.1.16948 WP_001095643.1.17049 WP_001095643.1.17058 WP_001095643.1.17078 WP_001095643.1.17202 WP_001095643.1.17219 WP_001095643.1.1722 WP_001095643.1.17302 WP_001095643.1.17308 WP_001095643.1.17368 WP_001095643.1.17405 WP_001095643.1.17406 WP_001095643.1.17513 WP_001095643.1.17543 WP_001095643.1.17563 WP_001095643.1.17578 WP_001095643.1.17622 WP_001095643.1.17659 WP_001095643.1.17667 WP_001095643.1.17686 WP_001095643.1.17741 WP_001095643.1.17840 WP_001095643.1.17956 WP_001095643.1.18005 WP_001095643.1.1801 WP_001095643.1.18021 WP_001095643.1.18099 WP_001095643.1.18124 WP_001095643.1.18144 WP_001095643.1.18173 WP_001095643.1.18270 WP_001095643.1.18280 WP_001095643.1.18328 WP_001095643.1.18358 WP_001095643.1.18370 WP_001095643.1.18406 WP_001095643.1.18474 WP_001095643.1.18513 WP_001095643.1.18610 WP_001095643.1.18678 WP_001095643.1.18722 WP_001095643.1.18766 WP_001095643.1.1880 WP_001095643.1.1885 WP_001095643.1.18860 WP_001095643.1.18922 WP_001095643.1.18959 WP_001095643.1.19001 WP_001095643.1.19006 WP_001095643.1.19044 WP_001095643.1.19084 WP_001095643.1.19187 WP_001095643.1.19228 WP_001095643.1.19288 WP_001095643.1.19300 WP_001095643.1.19422 WP_001095643.1.19454 WP_001095643.1.19456 WP_001095643.1.19496 WP_001095643.1.19535 WP_001095643.1.19538 WP_001095643.1.19589 WP_001095643.1.19663 WP_001095643.1.19686 WP_001095643.1.19731 WP_001095643.1.19794 WP_001095643.1.1992 WP_001095643.1.19999 WP_001095643.1.20254 WP_001095643.1.20255 WP_001095643.1.20296 WP_001095643.1.20339 WP_001095643.1.20419 WP_001095643.1.20465 WP_001095643.1.20492 WP_001095643.1.2053 WP_001095643.1.20635 WP_001095643.1.20718 WP_001095643.1.2073 WP_001095643.1.20740 WP_001095643.1.20828 WP_001095643.1.2087 WP_001095643.1.20883 WP_001095643.1.20947 WP_001095643.1.20953 WP_001095643.1.21010 WP_001095643.1.2106 WP_001095643.1.21062 WP_001095643.1.21144 WP_001095643.1.21162 WP_001095643.1.21184 WP_001095643.1.21185 WP_001095643.1.21366 WP_001095643.1.21492 WP_001095643.1.2166 WP_001095643.1.21674 WP_001095643.1.21946 WP_001095643.1.21966 WP_001095643.1.22064 WP_001095643.1.22118 WP_001095643.1.22126 WP_001095643.1.2216 WP_001095643.1.22208 WP_001095643.1.2227 WP_001095643.1.22373 WP_001095643.1.22476 WP_001095643.1.22614 WP_001095643.1.22652 WP_001095643.1.22683 WP_001095643.1.2284 WP_001095643.1.22895 WP_001095643.1.22926 WP_001095643.1.22943 WP_001095643.1.22967 WP_001095643.1.23040 WP_001095643.1.23058 WP_001095643.1.23218 WP_001095643.1.2331 WP_001095643.1.2332 WP_001095643.1.23340 WP_001095643.1.2336 WP_001095643.1.23365 WP_001095643.1.23412 WP_001095643.1.23426 WP_001095643.1.23492 WP_001095643.1.23515 WP_001095643.1.23548 WP_001095643.1.23571 WP_001095643.1.23604 WP_001095643.1.23679 WP_001095643.1.23728 WP_001095643.1.2375 WP_001095643.1.23783 WP_001095643.1.23786 WP_001095643.1.23787 WP_001095643.1.23801 WP_001095643.1.24028 WP_001095643.1.24061 WP_001095643.1.24083 WP_001095643.1.24117 WP_001095643.1.24125 WP_001095643.1.24138 WP_001095643.1.24153 WP_001095643.1.24291 WP_001095643.1.24322 WP_001095643.1.24355 WP_001095643.1.24375 WP_001095643.1.24400 WP_001095643.1.24619 WP_001095643.1.24643 WP_001095643.1.24688 WP_001095643.1.24716 WP_001095643.1.2481 WP_001095643.1.24832 WP_001095643.1.24964 WP_001095643.1.25017 WP_001095643.1.25032 WP_001095643.1.25041 WP_001095643.1.25053 WP_001095643.1.25140 WP_001095643.1.25185 WP_001095643.1.25196 WP_001095643.1.25210 WP_001095643.1.25219 WP_001095643.1.25304 WP_001095643.1.25374 WP_001095643.1.25475 WP_001095643.1.25490 WP_001095643.1.25508 WP_001095643.1.25512 WP_001095643.1.25603 WP_001095643.1.2562 WP_001095643.1.25666 WP_001095643.1.25807 WP_001095643.1.25821 WP_001095643.1.25833 WP_001095643.1.25835 WP_001095643.1.25882 WP_001095643.1.25911 WP_001095643.1.25962 WP_001095643.1.25963 WP_001095643.1.26001 WP_001095643.1.26027 WP_001095643.1.26107 WP_001095643.1.2615 WP_001095643.1.26217 WP_001095643.1.26230 WP_001095643.1.26232 WP_001095643.1.26272 WP_001095643.1.26286 WP_001095643.1.26288 WP_001095643.1.26394 WP_001095643.1.26491 WP_001095643.1.2654 WP_001095643.1.26554 WP_001095643.1.26636 WP_001095643.1.26689 WP_001095643.1.2679 WP_001095643.1.26908 WP_001095643.1.2692 WP_001095643.1.26928 WP_001095643.1.270 WP_001095643.1.27008 WP_001095643.1.27027 WP_001095643.1.27070 WP_001095643.1.27077 WP_001095643.1.27086 WP_001095643.1.27087 WP_001095643.1.27111 WP_001095643.1.27115 WP_001095643.1.2713 WP_001095643.1.2717 WP_001095643.1.27228 WP_001095643.1.27282 WP_001095643.1.27285 WP_001095643.1.27309 WP_001095643.1.27329 WP_001095643.1.27361 WP_001095643.1.27565 WP_001095643.1.27595 WP_001095643.1.27598 WP_001095643.1.27706 WP_001095643.1.27775 WP_001095643.1.27785 WP_001095643.1.27900 WP_001095643.1.27928 WP_001095643.1.27945 WP_001095643.1.28004 WP_001095643.1.2809 WP_001095643.1.28155 WP_001095643.1.28198 WP_001095643.1.2822 WP_001095643.1.28229 WP_001095643.1.28384 WP_001095643.1.28386 WP_001095643.1.28395 WP_001095643.1.284 WP_001095643.1.2845 WP_001095643.1.28479 WP_001095643.1.28627 WP_001095643.1.28692 WP_001095643.1.2873 WP_001095643.1.28917 WP_001095643.1.28962 WP_001095643.1.29023 WP_001095643.1.29042 WP_001095643.1.2905 WP_001095643.1.2907 WP_001095643.1.29081 WP_001095643.1.29089 WP_001095643.1.29153 WP_001095643.1.29203 WP_001095643.1.29237 WP_001095643.1.29248 WP_001095643.1.29288 WP_001095643.1.29389 WP_001095643.1.29439 WP_001095643.1.2946 WP_001095643.1.29462 WP_001095643.1.29563 WP_001095643.1.29727 WP_001095643.1.29743 WP_001095643.1.29782 WP_001095643.1.29833 WP_001095643.1.29851 WP_001095643.1.29865 WP_001095643.1.29886 WP_001095643.1.29919 WP_001095643.1.2994 WP_001095643.1.29964 WP_001095643.1.29983 WP_001095643.1.30009 WP_001095643.1.30013 WP_001095643.1.3002 WP_001095643.1.30034 WP_001095643.1.30049 WP_001095643.1.30058 WP_001095643.1.30172 WP_001095643.1.30185 WP_001095643.1.30354 WP_001095643.1.30357 WP_001095643.1.30362 WP_001095643.1.3042 WP_001095643.1.30421 WP_001095643.1.30440 WP_001095643.1.30448 WP_001095643.1.30489 WP_001095643.1.30517 WP_001095643.1.30542 WP_001095643.1.30544 WP_001095643.1.30556 WP_001095643.1.30572 WP_001095643.1.30585 WP_001095643.1.30618 WP_001095643.1.30664 WP_001095643.1.30688 WP_001095643.1.30806 WP_001095643.1.30967 WP_001095643.1.31046 WP_001095643.1.31066 WP_001095643.1.31078 WP_001095643.1.31139 WP_001095643.1.31145 WP_001095643.1.31182 WP_001095643.1.31205 WP_001095643.1.3121 WP_001095643.1.31223 WP_001095643.1.31303 WP_001095643.1.3131 WP_001095643.1.31352 WP_001095643.1.31389 WP_001095643.1.31413 WP_001095643.1.31446 WP_001095643.1.31533 WP_001095643.1.31799 WP_001095643.1.31836 WP_001095643.1.31951 WP_001095643.1.32041 WP_001095643.1.32042 WP_001095643.1.3207 WP_001095643.1.32189 WP_001095643.1.32202 WP_001095643.1.32263 WP_001095643.1.32293 WP_001095643.1.32299 WP_001095643.1.32422 WP_001095643.1.32425 WP_001095643.1.32458 WP_001095643.1.32460 WP_001095643.1.32529 WP_001095643.1.32563 WP_001095643.1.32578 WP_001095643.1.32617 WP_001095643.1.3270 WP_001095643.1.32725 WP_001095643.1.32838 WP_001095643.1.32848 WP_001095643.1.32868 WP_001095643.1.3290 WP_001095643.1.32940 WP_001095643.1.32941 WP_001095643.1.3296 WP_001095643.1.32966 WP_001095643.1.32985 WP_001095643.1.33037 WP_001095643.1.3305 WP_001095643.1.33051 WP_001095643.1.33065 WP_001095643.1.33122 WP_001095643.1.3315 WP_001095643.1.33208 WP_001095643.1.33214 WP_001095643.1.33247 WP_001095643.1.33280 WP_001095643.1.33283 WP_001095643.1.33313 WP_001095643.1.33339 WP_001095643.1.33382 WP_001095643.1.33490 WP_001095643.1.33501 WP_001095643.1.33529 WP_001095643.1.33689 WP_001095643.1.3370 WP_001095643.1.33730 WP_001095643.1.33741 WP_001095643.1.33840 WP_001095643.1.3392 WP_001095643.1.33926 WP_001095643.1.33957 WP_001095643.1.33969 WP_001095643.1.34001 WP_001095643.1.34059 WP_001095643.1.34118 WP_001095643.1.34211 WP_001095643.1.34214 WP_001095643.1.34234 WP_001095643.1.34284 WP_001095643.1.34376 WP_001095643.1.34382 WP_001095643.1.34484 WP_001095643.1.34517 WP_001095643.1.34530 WP_001095643.1.34665 WP_001095643.1.34694 WP_001095643.1.34751 WP_001095643.1.34808 WP_001095643.1.34824 WP_001095643.1.34834 WP_001095643.1.34932 WP_001095643.1.34962 WP_001095643.1.35001 WP_001095643.1.35040 WP_001095643.1.35074 WP_001095643.1.35175 WP_001095643.1.35240 WP_001095643.1.35274 WP_001095643.1.35532 WP_001095643.1.35560 WP_001095643.1.3557 WP_001095643.1.35628 WP_001095643.1.3570 WP_001095643.1.35712 WP_001095643.1.35713 WP_001095643.1.35736 WP_001095643.1.35791 WP_001095643.1.35795 WP_001095643.1.35870 WP_001095643.1.35916 WP_001095643.1.35938 WP_001095643.1.35966 WP_001095643.1.36000 WP_001095643.1.36034 WP_001095643.1.36036 WP_001095643.1.36069 WP_001095643.1.36291 WP_001095643.1.36298 WP_001095643.1.36308 WP_001095643.1.36323 WP_001095643.1.36343 WP_001095643.1.36460 WP_001095643.1.3649 WP_001095643.1.36495 WP_001095643.1.36526 WP_001095643.1.36567 WP_001095643.1.36579 WP_001095643.1.36617 WP_001095643.1.36618 WP_001095643.1.36643 WP_001095643.1.36663 WP_001095643.1.36701 WP_001095643.1.36725 WP_001095643.1.36779 WP_001095643.1.36798 WP_001095643.1.36802 WP_001095643.1.36821 WP_001095643.1.36853 WP_001095643.1.36950 WP_001095643.1.37014 WP_001095643.1.37133 WP_001095643.1.37176 WP_001095643.1.37199 WP_001095643.1.37200 WP_001095643.1.37258 WP_001095643.1.37303 WP_001095643.1.37513 WP_001095643.1.37584 WP_001095643.1.37590 WP_001095643.1.37593 WP_001095643.1.37600 WP_001095643.1.37613 WP_001095643.1.37659 WP_001095643.1.37662 WP_001095643.1.37675 WP_001095643.1.37691 WP_001095643.1.37761 WP_001095643.1.37775 WP_001095643.1.37777 WP_001095643.1.378 WP_001095643.1.379 WP_001095643.1.37911 WP_001095643.1.37941 WP_001095643.1.37985 WP_001095643.1.38061 WP_001095643.1.38064 WP_001095643.1.38108 WP_001095643.1.3816 WP_001095643.1.38207 WP_001095643.1.38261 WP_001095643.1.38266 WP_001095643.1.38310 WP_001095643.1.3834 WP_001095643.1.38351 WP_001095643.1.3838 WP_001095643.1.38440 WP_001095643.1.38486 WP_001095643.1.38515 WP_001095643.1.38595 WP_001095643.1.3860 WP_001095643.1.38642 WP_001095643.1.38734 WP_001095643.1.38877 WP_001095643.1.38983 WP_001095643.1.38996 WP_001095643.1.39056 WP_001095643.1.3907 WP_001095643.1.39105 WP_001095643.1.3914 WP_001095643.1.39147 WP_001095643.1.39161 WP_001095643.1.39210 WP_001095643.1.39235 WP_001095643.1.3931 WP_001095643.1.39435 WP_001095643.1.39502 WP_001095643.1.39530 WP_001095643.1.39619 WP_001095643.1.39620 WP_001095643.1.39624 WP_001095643.1.39659 WP_001095643.1.39667 WP_001095643.1.39775 WP_001095643.1.39879 WP_001095643.1.39890 WP_001095643.1.39941 WP_001095643.1.39945 WP_001095643.1.39947 WP_001095643.1.40095 WP_001095643.1.40097 WP_001095643.1.401 WP_001095643.1.40160 WP_001095643.1.40167 WP_001095643.1.40279 WP_001095643.1.40361 WP_001095643.1.4042 WP_001095643.1.40467 WP_001095643.1.40496 WP_001095643.1.40517 WP_001095643.1.40698 WP_001095643.1.40750 WP_001095643.1.40763 WP_001095643.1.40854 WP_001095643.1.4089 WP_001095643.1.40924 WP_001095643.1.40932 WP_001095643.1.40946 WP_001095643.1.41004 WP_001095643.1.4106 WP_001095643.1.41070 WP_001095643.1.41074 WP_001095643.1.41075 WP_001095643.1.41097 WP_001095643.1.41132 WP_001095643.1.41176 WP_001095643.1.41251 WP_001095643.1.41258 WP_001095643.1.41305 WP_001095643.1.41321 WP_001095643.1.41333 WP_001095643.1.41335 WP_001095643.1.4136 WP_001095643.1.41415 WP_001095643.1.41459 WP_001095643.1.41498 WP_001095643.1.41519 WP_001095643.1.41524 WP_001095643.1.41631 WP_001095643.1.41658 WP_001095643.1.41659 WP_001095643.1.41716 WP_001095643.1.41746 WP_001095643.1.41824 WP_001095643.1.41825 WP_001095643.1.41836 WP_001095643.1.41894 WP_001095643.1.41919 WP_001095643.1.41929 WP_001095643.1.4194 WP_001095643.1.42069 WP_001095643.1.42081 WP_001095643.1.42090 WP_001095643.1.42111 WP_001095643.1.42187 WP_001095643.1.42200 WP_001095643.1.42219 WP_001095643.1.42257 WP_001095643.1.42261 WP_001095643.1.42349 WP_001095643.1.42364 WP_001095643.1.42371 WP_001095643.1.42379 WP_001095643.1.42391 WP_001095643.1.42399 WP_001095643.1.42539 WP_001095643.1.42603 WP_001095643.1.42650 WP_001095643.1.4267 WP_001095643.1.42701 WP_001095643.1.42805 WP_001095643.1.42815 WP_001095643.1.42859 WP_001095643.1.4298 WP_001095643.1.43008 WP_001095643.1.43016 WP_001095643.1.43019 WP_001095643.1.43065 WP_001095643.1.43068 WP_001095643.1.43069 WP_001095643.1.43128 WP_001095643.1.43141 WP_001095643.1.43157 WP_001095643.1.43161 WP_001095643.1.43190 WP_001095643.1.43198 WP_001095643.1.4326 WP_001095643.1.43290 WP_001095643.1.43292 WP_001095643.1.43307 WP_001095643.1.43513 WP_001095643.1.43633 WP_001095643.1.43637 WP_001095643.1.43651 WP_001095643.1.43722 WP_001095643.1.43801 WP_001095643.1.43812 WP_001095643.1.43878 WP_001095643.1.43888 WP_001095643.1.43919 WP_001095643.1.43974 WP_001095643.1.44049 WP_001095643.1.44101 WP_001095643.1.44160 WP_001095643.1.44180 WP_001095643.1.44196 WP_001095643.1.44248 WP_001095643.1.44262 WP_001095643.1.44268 WP_001095643.1.4427 WP_001095643.1.44296 WP_001095643.1.44343 WP_001095643.1.44351 WP_001095643.1.44360 WP_001095643.1.44416 WP_001095643.1.44431 WP_001095643.1.44437 WP_001095643.1.44546 WP_001095643.1.4468 WP_001095643.1.44762 WP_001095643.1.44815 WP_001095643.1.44828 WP_001095643.1.44879 WP_001095643.1.44917 WP_001095643.1.4501 WP_001095643.1.45072 WP_001095643.1.45093 WP_001095643.1.45136 WP_001095643.1.45241 WP_001095643.1.45435 WP_001095643.1.45523 WP_001095643.1.45596 WP_001095643.1.45648 WP_001095643.1.45829 WP_001095643.1.45871 WP_001095643.1.46030 WP_001095643.1.46077 WP_001095643.1.46169 WP_001095643.1.46225 WP_001095643.1.46241 WP_001095643.1.46307 WP_001095643.1.46355 WP_001095643.1.464 WP_001095643.1.46454 WP_001095643.1.46461 WP_001095643.1.46504 WP_001095643.1.46505 WP_001095643.1.46551 WP_001095643.1.46559 WP_001095643.1.46701 WP_001095643.1.46781 WP_001095643.1.46816 WP_001095643.1.46842 WP_001095643.1.4690 WP_001095643.1.46920 WP_001095643.1.46945 WP_001095643.1.47036 WP_001095643.1.47037 WP_001095643.1.47042 WP_001095643.1.47059 WP_001095643.1.47085 WP_001095643.1.47123 WP_001095643.1.47215 WP_001095643.1.47245 WP_001095643.1.47523 WP_001095643.1.47531 WP_001095643.1.47532 WP_001095643.1.47605 WP_001095643.1.47630 WP_001095643.1.4774 WP_001095643.1.47756 WP_001095643.1.4781 WP_001095643.1.47886 WP_001095643.1.47898 WP_001095643.1.48019 WP_001095643.1.48100 WP_001095643.1.48114 WP_001095643.1.48139 WP_001095643.1.48190 WP_001095643.1.48292 WP_001095643.1.48324 WP_001095643.1.48426 WP_001095643.1.48430 WP_001095643.1.48436 WP_001095643.1.48586 WP_001095643.1.4859 WP_001095643.1.48591 WP_001095643.1.48610 WP_001095643.1.48631 WP_001095643.1.48663 WP_001095643.1.48690 WP_001095643.1.48734 WP_001095643.1.48756 WP_001095643.1.48778 WP_001095643.1.48849 WP_001095643.1.48955 WP_001095643.1.48963 WP_001095643.1.48973 WP_001095643.1.49004 WP_001095643.1.49106 WP_001095643.1.49117 WP_001095643.1.49121 WP_001095643.1.4914 WP_001095643.1.49140 WP_001095643.1.49153 WP_001095643.1.49166 WP_001095643.1.49355 WP_001095643.1.49429 WP_001095643.1.49434 WP_001095643.1.49450 WP_001095643.1.495 WP_001095643.1.49545 WP_001095643.1.49703 WP_001095643.1.49769 WP_001095643.1.49846 WP_001095643.1.4991 WP_001095643.1.49947 WP_001095643.1.49959 WP_001095643.1.49997 WP_001095643.1.50014 WP_001095643.1.50030 WP_001095643.1.50043 WP_001095643.1.50103 WP_001095643.1.50158 WP_001095643.1.50247 WP_001095643.1.50308 WP_001095643.1.50309 WP_001095643.1.50387 WP_001095643.1.50406 WP_001095643.1.50468 WP_001095643.1.5051 WP_001095643.1.50566 WP_001095643.1.50570 WP_001095643.1.50626 WP_001095643.1.50726 WP_001095643.1.50771 WP_001095643.1.50875 WP_001095643.1.50885 WP_001095643.1.509 WP_001095643.1.50929 WP_001095643.1.50970 WP_001095643.1.51040 WP_001095643.1.51048 WP_001095643.1.51100 WP_001095643.1.51134 WP_001095643.1.51227 WP_001095643.1.5127 WP_001095643.1.51305 WP_001095643.1.51315 WP_001095643.1.5136 WP_001095643.1.51474 WP_001095643.1.51519 WP_001095643.1.51598 WP_001095643.1.51644 WP_001095643.1.51724 WP_001095643.1.51734 WP_001095643.1.51838 WP_001095643.1.51863 WP_001095643.1.51935 WP_001095643.1.52057 WP_001095643.1.52129 WP_001095643.1.52191 WP_001095643.1.52202 WP_001095643.1.52209 WP_001095643.1.52339 WP_001095643.1.52469 WP_001095643.1.52571 WP_001095643.1.526 WP_001095643.1.52647 WP_001095643.1.52742 WP_001095643.1.52773 WP_001095643.1.52795 WP_001095643.1.52807 WP_001095643.1.52887 WP_001095643.1.53092 WP_001095643.1.53141 WP_001095643.1.53151 WP_001095643.1.53154 WP_001095643.1.53159 WP_001095643.1.53210 WP_001095643.1.53233 WP_001095643.1.53307 WP_001095643.1.53321 WP_001095643.1.53368 WP_001095643.1.53375 WP_001095643.1.53450 WP_001095643.1.5349 WP_001095643.1.53540 WP_001095643.1.53555 WP_001095643.1.53559 WP_001095643.1.5356 WP_001095643.1.53571 WP_001095643.1.5358 WP_001095643.1.53692 WP_001095643.1.53723 WP_001095643.1.5374 WP_001095643.1.53750 WP_001095643.1.53800 WP_001095643.1.53815 WP_001095643.1.53839 WP_001095643.1.53892 WP_001095643.1.53898 WP_001095643.1.53902 WP_001095643.1.53958 WP_001095643.1.53981 WP_001095643.1.53984 WP_001095643.1.54132 WP_001095643.1.54170 WP_001095643.1.54175 WP_001095643.1.54203 WP_001095643.1.54259 WP_001095643.1.5430 WP_001095643.1.54371 WP_001095643.1.54431 WP_001095643.1.54442 WP_001095643.1.54482 WP_001095643.1.54589 WP_001095643.1.54667 WP_001095643.1.54678 WP_001095643.1.54681 WP_001095643.1.54748 WP_001095643.1.5481 WP_001095643.1.54865 WP_001095643.1.54935 WP_001095643.1.54979 WP_001095643.1.55010 WP_001095643.1.55034 WP_001095643.1.55163 WP_001095643.1.55165 WP_001095643.1.55215 WP_001095643.1.55290 WP_001095643.1.55310 WP_001095643.1.55317 WP_001095643.1.55379 WP_001095643.1.5539 WP_001095643.1.55468 WP_001095643.1.55506 WP_001095643.1.55604 WP_001095643.1.55639 WP_001095643.1.55699 WP_001095643.1.55725 WP_001095643.1.55780 WP_001095643.1.55967 WP_001095643.1.56144 WP_001095643.1.56172 WP_001095643.1.5621 WP_001095643.1.56226 WP_001095643.1.56311 WP_001095643.1.56419 WP_001095643.1.56423 WP_001095643.1.56514 WP_001095643.1.56535 WP_001095643.1.56585 WP_001095643.1.56640 WP_001095643.1.56724 WP_001095643.1.56825 WP_001095643.1.56887 WP_001095643.1.56889 WP_001095643.1.56981 WP_001095643.1.57101 WP_001095643.1.57137 WP_001095643.1.57147 WP_001095643.1.57179 WP_001095643.1.57186 WP_001095643.1.57342 WP_001095643.1.57684 WP_001095643.1.57699 WP_001095643.1.57785 WP_001095643.1.57800 WP_001095643.1.57873 WP_001095643.1.57965 WP_001095643.1.57972 WP_001095643.1.58008 WP_001095643.1.58044 WP_001095643.1.58081 WP_001095643.1.5809 WP_001095643.1.58132 WP_001095643.1.58173 WP_001095643.1.58191 WP_001095643.1.58194 WP_001095643.1.58252 WP_001095643.1.58261 WP_001095643.1.58274 WP_001095643.1.58282 WP_001095643.1.58324 WP_001095643.1.58326 WP_001095643.1.5836 WP_001095643.1.58485 WP_001095643.1.58537 WP_001095643.1.58568 WP_001095643.1.58583 WP_001095643.1.58652 WP_001095643.1.58663 WP_001095643.1.58724 WP_001095643.1.5875 WP_001095643.1.58796 WP_001095643.1.58807 WP_001095643.1.58847 WP_001095643.1.58883 WP_001095643.1.58898 WP_001095643.1.58949 WP_001095643.1.58963 WP_001095643.1.58970 WP_001095643.1.58974 WP_001095643.1.59020 WP_001095643.1.59043 WP_001095643.1.59056 WP_001095643.1.59061 WP_001095643.1.59064 WP_001095643.1.59282 WP_001095643.1.59299 WP_001095643.1.59313 WP_001095643.1.5949 WP_001095643.1.59501 WP_001095643.1.59510 WP_001095643.1.5969 WP_001095643.1.59751 WP_001095643.1.59827 WP_001095643.1.59829 WP_001095643.1.59847 WP_001095643.1.59863 WP_001095643.1.59969 WP_001095643.1.59994 WP_001095643.1.60045 WP_001095643.1.60076 WP_001095643.1.60114 WP_001095643.1.60154 WP_001095643.1.60168 WP_001095643.1.60192 WP_001095643.1.60199 WP_001095643.1.60212 WP_001095643.1.60253 WP_001095643.1.60322 WP_001095643.1.60324 WP_001095643.1.60356 WP_001095643.1.6038 WP_001095643.1.60380 WP_001095643.1.6041 WP_001095643.1.60424 WP_001095643.1.60481 WP_001095643.1.605 WP_001095643.1.6058 WP_001095643.1.60584 WP_001095643.1.6060 WP_001095643.1.60676 WP_001095643.1.60708 WP_001095643.1.60725 WP_001095643.1.60783 WP_001095643.1.60792 WP_001095643.1.60807 WP_001095643.1.60882 WP_001095643.1.60889 WP_001095643.1.60950 WP_001095643.1.6104 WP_001095643.1.61044 WP_001095643.1.61076 WP_001095643.1.61123 WP_001095643.1.61147 WP_001095643.1.61168 WP_001095643.1.61210 WP_001095643.1.61357 WP_001095643.1.61511 WP_001095643.1.61539 WP_001095643.1.61542 WP_001095643.1.61553 WP_001095643.1.61649 WP_001095643.1.61652 WP_001095643.1.61697 WP_001095643.1.61809 WP_001095643.1.61877 WP_001095643.1.61920 WP_001095643.1.62124 WP_001095643.1.62199 WP_001095643.1.62223 WP_001095643.1.62302 WP_001095643.1.62314 WP_001095643.1.62323 WP_001095643.1.62333 WP_001095643.1.62338 WP_001095643.1.62380 WP_001095643.1.62411 WP_001095643.1.62436 WP_001095643.1.62475 WP_001095643.1.62536 WP_001095643.1.62640 WP_001095643.1.62686 WP_001095643.1.62751 WP_001095643.1.62825 WP_001095643.1.62913 WP_001095643.1.62932 WP_001095643.1.62960 WP_001095643.1.63016 WP_001095643.1.63025 WP_001095643.1.63069 WP_001095643.1.63087 WP_001095643.1.63169 WP_001095643.1.63297 WP_001095643.1.63448 WP_001095643.1.63514 WP_001095643.1.63583 WP_001095643.1.63592 WP_001095643.1.63663 WP_001095643.1.63736 WP_001095643.1.63816 WP_001095643.1.63876 WP_001095643.1.6389 WP_001095643.1.63901 WP_001095643.1.63955 WP_001095643.1.63963 WP_001095643.1.64032 WP_001095643.1.64087 WP_001095643.1.6415 WP_001095643.1.64293 WP_001095643.1.64332 WP_001095643.1.64376 WP_001095643.1.644 WP_001095643.1.64471 WP_001095643.1.64501 WP_001095643.1.64538 WP_001095643.1.64632 WP_001095643.1.64648 WP_001095643.1.64654 WP_001095643.1.64662 WP_001095643.1.64663 WP_001095643.1.64709 WP_001095643.1.64710 WP_001095643.1.64744 WP_001095643.1.64763 WP_001095643.1.64817 WP_001095643.1.64847 WP_001095643.1.6487 WP_001095643.1.64891 WP_001095643.1.64974 WP_001095643.1.65054 WP_001095643.1.65075 WP_001095643.1.6514 WP_001095643.1.65172 WP_001095643.1.65191 WP_001095643.1.65200 WP_001095643.1.65211 WP_001095643.1.65218 WP_001095643.1.65226 WP_001095643.1.65249 WP_001095643.1.65266 WP_001095643.1.65395 WP_001095643.1.65459 WP_001095643.1.65463 WP_001095643.1.65487 WP_001095643.1.6549 WP_001095643.1.65499 WP_001095643.1.6554 WP_001095643.1.65650 WP_001095643.1.65697 WP_001095643.1.65699 WP_001095643.1.65737 WP_001095643.1.65755 WP_001095643.1.65812 WP_001095643.1.65846 WP_001095643.1.65863 WP_001095643.1.65985 WP_001095643.1.66021 WP_001095643.1.66031 WP_001095643.1.66052 WP_001095643.1.66064 WP_001095643.1.66109 WP_001095643.1.66145 WP_001095643.1.66183 WP_001095643.1.6620 WP_001095643.1.66216 WP_001095643.1.66234 WP_001095643.1.66273 WP_001095643.1.66324 WP_001095643.1.6634 WP_001095643.1.66361 WP_001095643.1.66480 WP_001095643.1.66506 WP_001095643.1.66665 WP_001095643.1.66681 WP_001095643.1.66684 WP_001095643.1.66755 WP_001095643.1.66759 WP_001095643.1.66801 WP_001095643.1.66860 WP_001095643.1.66953 WP_001095643.1.66955 WP_001095643.1.66981 WP_001095643.1.67024 WP_001095643.1.67042 WP_001095643.1.67101 WP_001095643.1.67143 WP_001095643.1.67201 WP_001095643.1.67211 WP_001095643.1.67237 WP_001095643.1.67336 WP_001095643.1.67339 WP_001095643.1.67387 WP_001095643.1.67394 WP_001095643.1.67397 WP_001095643.1.67403 WP_001095643.1.67430 WP_001095643.1.67442 WP_001095643.1.67539 WP_001095643.1.67556 WP_001095643.1.67576 WP_001095643.1.67604 WP_001095643.1.67619 WP_001095643.1.67625 WP_001095643.1.67627 WP_001095643.1.67641 WP_001095643.1.67657 WP_001095643.1.67673 WP_001095643.1.67700 WP_001095643.1.67718 WP_001095643.1.67729 WP_001095643.1.67774 WP_001095643.1.67820 WP_001095643.1.67910 WP_001095643.1.67954 WP_001095643.1.68 WP_001095643.1.68043 WP_001095643.1.68105 WP_001095643.1.68113 WP_001095643.1.68131 WP_001095643.1.68182 WP_001095643.1.6819 WP_001095643.1.68285 WP_001095643.1.68359 WP_001095643.1.68420 WP_001095643.1.68514 WP_001095643.1.68564 WP_001095643.1.68688 WP_001095643.1.68742 WP_001095643.1.68770 WP_001095643.1.68809 WP_001095643.1.68914 WP_001095643.1.69170 WP_001095643.1.69210 WP_001095643.1.69270 WP_001095643.1.69282 WP_001095643.1.69376 WP_001095643.1.69396 WP_001095643.1.69466 WP_001095643.1.69611 WP_001095643.1.69642 WP_001095643.1.69656 WP_001095643.1.69657 WP_001095643.1.69690 WP_001095643.1.69923 WP_001095643.1.69948 WP_001095643.1.69953 WP_001095643.1.70010 WP_001095643.1.70049 WP_001095643.1.70058 WP_001095643.1.70061 WP_001095643.1.70205 WP_001095643.1.70240 WP_001095643.1.70249 WP_001095643.1.70261 WP_001095643.1.70314 WP_001095643.1.7033 WP_001095643.1.70427 WP_001095643.1.70433 WP_001095643.1.70545 WP_001095643.1.70623 WP_001095643.1.70671 WP_001095643.1.70679 WP_001095643.1.70708 WP_001095643.1.70717 WP_001095643.1.70731 WP_001095643.1.70772 WP_001095643.1.70845 WP_001095643.1.70846 WP_001095643.1.70981 WP_001095643.1.70995 WP_001095643.1.71039 WP_001095643.1.71057 WP_001095643.1.71081 WP_001095643.1.71117 WP_001095643.1.71186 WP_001095643.1.71455 WP_001095643.1.71456 WP_001095643.1.71487 WP_001095643.1.71523 WP_001095643.1.71542 WP_001095643.1.71566 WP_001095643.1.71640 WP_001095643.1.71651 WP_001095643.1.71653 WP_001095643.1.71716 WP_001095643.1.71872 WP_001095643.1.71950 WP_001095643.1.71954 WP_001095643.1.71985 WP_001095643.1.72003 WP_001095643.1.72073 WP_001095643.1.72269 WP_001095643.1.72350 WP_001095643.1.72383 WP_001095643.1.72461 WP_001095643.1.72527 WP_001095643.1.7255 WP_001095643.1.72631 WP_001095643.1.72638 WP_001095643.1.72667 WP_001095643.1.72674 WP_001095643.1.72724 WP_001095643.1.72789 WP_001095643.1.72828 WP_001095643.1.72896 WP_001095643.1.72969 WP_001095643.1.72987 WP_001095643.1.73052 WP_001095643.1.7311 WP_001095643.1.73114 WP_001095643.1.73177 WP_001095643.1.73180 WP_001095643.1.73258 WP_001095643.1.73285 WP_001095643.1.7332 WP_001095643.1.7333 WP_001095643.1.73352 WP_001095643.1.73389 WP_001095643.1.73425 WP_001095643.1.73488 WP_001095643.1.73504 WP_001095643.1.7353 WP_001095643.1.73544 WP_001095643.1.73598 WP_001095643.1.7361 WP_001095643.1.73648 WP_001095643.1.73768 WP_001095643.1.73849 WP_001095643.1.73948 WP_001095643.1.73999 WP_001095643.1.74024 WP_001095643.1.74030 WP_001095643.1.74038 WP_001095643.1.74043 WP_001095643.1.74058 WP_001095643.1.74070 WP_001095643.1.74077 WP_001095643.1.74135 WP_001095643.1.74214 WP_001095643.1.74241 WP_001095643.1.74285 WP_001095643.1.7430 WP_001095643.1.74317 WP_001095643.1.74415 WP_001095643.1.74616 WP_001095643.1.74621 WP_001095643.1.74647 WP_001095643.1.74677 WP_001095643.1.74699 WP_001095643.1.74831 WP_001095643.1.74894 WP_001095643.1.74929 WP_001095643.1.74939 WP_001095643.1.74973 WP_001095643.1.7507 WP_001095643.1.75089 WP_001095643.1.75116 WP_001095643.1.75237 WP_001095643.1.75273 WP_001095643.1.75296 WP_001095643.1.75413 WP_001095643.1.75433 WP_001095643.1.75532 WP_001095643.1.75565 WP_001095643.1.75593 WP_001095643.1.75610 WP_001095643.1.75633 WP_001095643.1.75718 WP_001095643.1.75745 WP_001095643.1.75844 WP_001095643.1.75886 WP_001095643.1.75898 WP_001095643.1.76081 WP_001095643.1.76116 WP_001095643.1.76122 WP_001095643.1.76256 WP_001095643.1.76339 WP_001095643.1.76366 WP_001095643.1.76417 WP_001095643.1.7646 WP_001095643.1.76510 WP_001095643.1.76558 WP_001095643.1.76572 WP_001095643.1.76641 WP_001095643.1.76651 WP_001095643.1.76653 WP_001095643.1.76788 WP_001095643.1.76854 WP_001095643.1.76916 WP_001095643.1.76932 WP_001095643.1.76973 WP_001095643.1.76988 WP_001095643.1.77016 WP_001095643.1.77087 WP_001095643.1.77090 WP_001095643.1.77111 WP_001095643.1.77299 WP_001095643.1.77384 WP_001095643.1.77501 WP_001095643.1.77512 WP_001095643.1.77513 WP_001095643.1.77563 WP_001095643.1.77702 WP_001095643.1.77713 WP_001095643.1.7772 WP_001095643.1.77825 WP_001095643.1.77837 WP_001095643.1.77900 WP_001095643.1.77923 WP_001095643.1.77975 WP_001095643.1.78035 WP_001095643.1.78048 WP_001095643.1.78107 WP_001095643.1.78166 WP_001095643.1.78192 WP_001095643.1.78195 WP_001095643.1.78291 WP_001095643.1.78309 WP_001095643.1.78320 WP_001095643.1.78382 WP_001095643.1.78388 WP_001095643.1.78410 WP_001095643.1.7862 WP_001095643.1.78626 WP_001095643.1.78661 WP_001095643.1.78674 WP_001095643.1.78676 WP_001095643.1.78761 WP_001095643.1.789 WP_001095643.1.78993 WP_001095643.1.79012 WP_001095643.1.79069 WP_001095643.1.79074 WP_001095643.1.79098 WP_001095643.1.79155 WP_001095643.1.79164 WP_001095643.1.79204 WP_001095643.1.79280 WP_001095643.1.79397 WP_001095643.1.79456 WP_001095643.1.79532 WP_001095643.1.79547 WP_001095643.1.79654 WP_001095643.1.7970 WP_001095643.1.79722 WP_001095643.1.79772 WP_001095643.1.79880 WP_001095643.1.79916 WP_001095643.1.80065 WP_001095643.1.80103 WP_001095643.1.80273 WP_001095643.1.80282 WP_001095643.1.80354 WP_001095643.1.80368 WP_001095643.1.80386 WP_001095643.1.80400 WP_001095643.1.80462 WP_001095643.1.8049 WP_001095643.1.80492 WP_001095643.1.80569 WP_001095643.1.80664 WP_001095643.1.80696 WP_001095643.1.80984 WP_001095643.1.81131 WP_001095643.1.81187 WP_001095643.1.81262 WP_001095643.1.81268 WP_001095643.1.81269 WP_001095643.1.81271 WP_001095643.1.8131 WP_001095643.1.81333 WP_001095643.1.81342 WP_001095643.1.81364 WP_001095643.1.81494 WP_001095643.1.81557 WP_001095643.1.81676 WP_001095643.1.81681 WP_001095643.1.8170 WP_001095643.1.81763 WP_001095643.1.81855 WP_001095643.1.81921 WP_001095643.1.81931 WP_001095643.1.81936 WP_001095643.1.81949 WP_001095643.1.82070 WP_001095643.1.82076 WP_001095643.1.82131 WP_001095643.1.82156 WP_001095643.1.8218 WP_001095643.1.82180 WP_001095643.1.82201 WP_001095643.1.82214 WP_001095643.1.82225 WP_001095643.1.8240 WP_001095643.1.82408 WP_001095643.1.82416 WP_001095643.1.8242 WP_001095643.1.82456 WP_001095643.1.82465 WP_001095643.1.82473 WP_001095643.1.82553 WP_001095643.1.82646 WP_001095643.1.82670 WP_001095643.1.82731 WP_001095643.1.82812 WP_001095643.1.82850 WP_001095643.1.82872 WP_001095643.1.8294 WP_001095643.1.82959 WP_001095643.1.83007 WP_001095643.1.8304 WP_001095643.1.83180 WP_001095643.1.83229 WP_001095643.1.83235 WP_001095643.1.83290 WP_001095643.1.83333 WP_001095643.1.83657 WP_001095643.1.83677 WP_001095643.1.8375 WP_001095643.1.83923 WP_001095643.1.83994 WP_001095643.1.84 WP_001095643.1.8406 WP_001095643.1.84076 WP_001095643.1.84110 WP_001095643.1.84127 WP_001095643.1.84150 WP_001095643.1.84230 WP_001095643.1.84252 WP_001095643.1.8431 WP_001095643.1.84345 WP_001095643.1.84369 WP_001095643.1.84401 WP_001095643.1.84435 WP_001095643.1.84567 WP_001095643.1.84631 WP_001095643.1.84727 WP_001095643.1.84744 WP_001095643.1.84773 WP_001095643.1.84945 WP_001095643.1.84967 WP_001095643.1.85004 WP_001095643.1.8502 WP_001095643.1.85039 WP_001095643.1.85153 WP_001095643.1.85273 WP_001095643.1.85338 WP_001095643.1.85339 WP_001095643.1.85511 WP_001095643.1.85512 WP_001095643.1.8557 WP_001095643.1.85606 WP_001095643.1.85635 WP_001095643.1.85646 WP_001095643.1.85665 WP_001095643.1.85669 WP_001095643.1.85688 WP_001095643.1.85703 WP_001095643.1.85728 WP_001095643.1.85746 WP_001095643.1.85811 WP_001095643.1.859 WP_001095643.1.85917 WP_001095643.1.8594 WP_001095643.1.85977 WP_001095643.1.860 WP_001095643.1.8605 WP_001095643.1.86084 WP_001095643.1.8610 WP_001095643.1.8614 WP_001095643.1.86156 WP_001095643.1.86323 WP_001095643.1.86342 WP_001095643.1.8640 WP_001095643.1.8642 WP_001095643.1.86426 WP_001095643.1.86489 WP_001095643.1.86530 WP_001095643.1.86663 WP_001095643.1.86770 WP_001095643.1.86794 WP_001095643.1.86800 WP_001095643.1.86811 WP_001095643.1.86815 WP_001095643.1.86945 WP_001095643.1.86989 WP_001095643.1.87023 WP_001095643.1.87034 WP_001095643.1.87041 WP_001095643.1.87136 WP_001095643.1.87155 WP_001095643.1.87258 WP_001095643.1.87293 WP_001095643.1.87420 WP_001095643.1.87528 WP_001095643.1.87560 WP_001095643.1.8760 WP_001095643.1.87600 WP_001095643.1.87609 WP_001095643.1.87612 WP_001095643.1.87615 WP_001095643.1.87653 WP_001095643.1.87659 WP_001095643.1.87698 WP_001095643.1.87706 WP_001095643.1.87739 WP_001095643.1.87741 WP_001095643.1.87742 WP_001095643.1.87852 WP_001095643.1.87949 WP_001095643.1.88025 WP_001095643.1.88026 WP_001095643.1.8805 WP_001095643.1.8806 WP_001095643.1.881 WP_001095643.1.88145 WP_001095643.1.88199 WP_001095643.1.88299 WP_001095643.1.88313 WP_001095643.1.88359 WP_001095643.1.88407 WP_001095643.1.88414 WP_001095643.1.88444 WP_001095643.1.88446 WP_001095643.1.88458 WP_001095643.1.88501 WP_001095643.1.88538 WP_001095643.1.88547 WP_001095643.1.886 WP_001095643.1.88647 WP_001095643.1.88648 WP_001095643.1.88692 WP_001095643.1.88707 WP_001095643.1.88727 WP_001095643.1.88772 WP_001095643.1.88850 WP_001095643.1.8889 WP_001095643.1.88892 WP_001095643.1.88894 WP_001095643.1.89182 WP_001095643.1.89298 WP_001095643.1.89308 WP_001095643.1.89314 WP_001095643.1.89328 WP_001095643.1.89332 WP_001095643.1.89343 WP_001095643.1.89395 WP_001095643.1.8940 WP_001095643.1.89449 WP_001095643.1.8947 WP_001095643.1.89503 WP_001095643.1.89591 WP_001095643.1.89612 WP_001095643.1.89668 WP_001095643.1.89706 WP_001095643.1.89713 WP_001095643.1.89733 WP_001095643.1.89796 WP_001095643.1.89804 WP_001095643.1.89845 WP_001095643.1.89888 WP_001095643.1.89911 WP_001095643.1.8995 WP_001095643.1.89952 WP_001095643.1.90007 WP_001095643.1.9011 WP_001095643.1.90196 WP_001095643.1.90240 WP_001095643.1.90274 WP_001095643.1.90280 WP_001095643.1.90330 WP_001095643.1.90338 WP_001095643.1.90365 WP_001095643.1.90428 WP_001095643.1.90489 WP_001095643.1.90513 WP_001095643.1.90582 WP_001095643.1.90713 WP_001095643.1.90794 WP_001095643.1.90796 WP_001095643.1.90811 WP_001095643.1.9091 WP_001095643.1.91067 WP_001095643.1.91164 WP_001095643.1.91205 WP_001095643.1.91239 WP_001095643.1.91291 WP_001095643.1.91313 WP_001095643.1.9135 WP_001095643.1.91506 WP_001095643.1.91557 WP_001095643.1.91597 WP_001095643.1.91715 WP_001095643.1.9187 WP_001095643.1.91870 WP_001095643.1.92018 WP_001095643.1.92087 WP_001095643.1.92098 WP_001095643.1.92156 WP_001095643.1.92172 WP_001095643.1.92240 WP_001095643.1.92243 WP_001095643.1.92327 WP_001095643.1.92470 WP_001095643.1.92477 WP_001095643.1.92545 WP_001095643.1.92570 WP_001095643.1.92588 WP_001095643.1.926 WP_001095643.1.92633 WP_001095643.1.92649 WP_001095643.1.92676 WP_001095643.1.92705 WP_001095643.1.9271 WP_001095643.1.92734 WP_001095643.1.92810 WP_001095643.1.92823 WP_001095643.1.92987 WP_001095643.1.93007 WP_001095643.1.93022 WP_001095643.1.93103 WP_001095643.1.93105 WP_001095643.1.93111 WP_001095643.1.93121 WP_001095643.1.93168 WP_001095643.1.93184 WP_001095643.1.93221 WP_001095643.1.93223 WP_001095643.1.93239 WP_001095643.1.93302 WP_001095643.1.9336 WP_001095643.1.93387 WP_001095643.1.93469 WP_001095643.1.93511 WP_001095643.1.93512 WP_001095643.1.93635 WP_001095643.1.93657 WP_001095643.1.9374 WP_001095643.1.9375 WP_001095643.1.93754 WP_001095643.1.93780 WP_001095643.1.93828 WP_001095643.1.93842 WP_001095643.1.93843 WP_001095643.1.93875 WP_001095643.1.93909 WP_001095643.1.93919 WP_001095643.1.93938 WP_001095643.1.93984 WP_001095643.1.9399 WP_001095643.1.94017 WP_001095643.1.94079 WP_001095643.1.94097 WP_001095643.1.94107 WP_001095643.1.94142 WP_001095643.1.94215 WP_001095643.1.94303 WP_001095643.1.94365 WP_001095643.1.94390 WP_001095643.1.94415 WP_001095643.1.94492 WP_001095643.1.94510 WP_001095643.1.94527 WP_001095643.1.94573 WP_001095643.1.94579 WP_001095643.1.94586 WP_001095643.1.94593 WP_001095643.1.94650 WP_001095643.1.94659 WP_001095643.1.94662 WP_001095643.1.94700 WP_001095643.1.94745 WP_001095643.1.94782 WP_001095643.1.94815 WP_001095643.1.94820 WP_001095643.1.94850 WP_001095643.1.94851 WP_001095643.1.94864 WP_001095643.1.94952 WP_001095643.1.95006 WP_001095643.1.95055 WP_001095643.1.95076 WP_001095643.1.95099 WP_001095643.1.95165 WP_001095643.1.95239 WP_001095643.1.95246 WP_001095643.1.9525 WP_001095643.1.95255 WP_001095643.1.95265 WP_001095643.1.95338 WP_001095643.1.95412 WP_001095643.1.95530 WP_001095643.1.95547 WP_001095643.1.95590 WP_001095643.1.95625 WP_001095643.1.95675 WP_001095643.1.95716 WP_001095643.1.95776 WP_001095643.1.95884 WP_001095643.1.95890 WP_001095643.1.95906 WP_001095643.1.96025 WP_001095643.1.96044 WP_001095643.1.96054 WP_001095643.1.96094 WP_001095643.1.96127 WP_001095643.1.96144 WP_001095643.1.96188 WP_001095643.1.96211 WP_001095643.1.96212 WP_001095643.1.96319 WP_001095643.1.9633 WP_001095643.1.96359 WP_001095643.1.96539 WP_001095643.1.96552 WP_001095643.1.96610 WP_001095643.1.96625 WP_001095643.1.96635 WP_001095643.1.9664 WP_001095643.1.96675 WP_001095643.1.9670 WP_001095643.1.96750 WP_001095643.1.96792 WP_001095643.1.96801 WP_001095643.1.96803 WP_001095643.1.96925 WP_001095643.1.96938 WP_001095643.1.96946 WP_001095643.1.96957 WP_001095643.1.96978 WP_001095643.1.97026 WP_001095643.1.97028 WP_001095643.1.97079 WP_001095643.1.97154 WP_001095643.1.97184 WP_001095643.1.97287 WP_001095643.1.97291 WP_001095643.1.97422 WP_001095643.1.97441 WP_001095643.1.97497 WP_001095643.1.97505 WP_001095643.1.97599 WP_001095643.1.97606 WP_001095643.1.97615 WP_001095643.1.97646 WP_001095643.1.97690 WP_001095643.1.97819 WP_001095643.1.97840 WP_001095643.1.97938 WP_001095643.1.97986 WP_001095643.1.98036 WP_001095643.1.98080 WP_001095643.1.98086 WP_001095643.1.98158 WP_001095643.1.98263 WP_001095643.1.98418 WP_001095643.1.98448 WP_001095643.1.98457 WP_001095643.1.9850 WP_001095643.1.98502 WP_001095643.1.98607 WP_001095643.1.98731 WP_001095643.1.98762 WP_001095643.1.9877 WP_001095643.1.98801 WP_001095643.1.98818 WP_001095643.1.99163 WP_001095643.1.99335 WP_001095643.1.99350 WP_001095643.1.99360 WP_001095643.1.99363 WP_001095643.1.99369 WP_001095643.1.99388 WP_001095643.1.99397 WP_001095643.1.99463 WP_001095643.1.99483 WP_001095643.1.99546 WP_001095643.1.99579 WP_001095643.1.99595 WP_001095643.1.99671 WP_001095643.1.99676 WP_001095643.1.99764 WP_001095643.1.99829 WP_001095643.1.99837 WP_001095643.1.99841 WP_001095643.1.9992 WP_001095643.1.99996 gi|29143055|ref|NP_806397.1| 209261.t2687 220341.STY2912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]