SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16761762|ref|NP_457379.1| from Salmonella enterica subsp. enterica serovar Typhi str. CT18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16761762|ref|NP_457379.1|
Domain Number 1 Region: 5-397
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.16e-107
Family Cystathionine synthase-like 0.00000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16761762|ref|NP_457379.1|
Sequence length 401
Comment aminotransferase [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
Sequence
MNAFNPTQFRAQFPALADAGVYLDSAATALKPQAVIDATHQFYCLSAGNVHRSQFAQAQR
LTAQYEAARAKAARLLNAPDEKSIVWTRGTTEAINMVAQCYARPRLRPGDEIIVSVAEHH
ANLVPWLMVAQQTGAQVIKLPLNDRRLPDVERLPELITSRSRILALGQMSNVTGGCPDLT
GAISAAHAAGMVVMIDGAQGAVHFPADVQQLDIDFYAFSAHKLYGPTGIGVLYGKPELLE
AMSPWLGGGKMIRDVSFEGFTTQSAPWKLEAGTPNVAGVIGLSAALEWLSDIDIEQAENW
SRGLATLAEDALAKRPGFRSFRCQDSSLLAFDFVGVHHGDMVTLLAEYGIALRAGQHCAQ
PLLAELGVTGTLRASFAPYNTQHDVDALVNAVDRALELLVD
Download sequence
Identical sequences Q8Z426
gi|378961063|ref|YP_005218549.1| gi|488655361|ref|YP_007927164.1| NP_457379.1.84458 WP_000991058.1.100008 WP_000991058.1.100036 WP_000991058.1.100079 WP_000991058.1.100196 WP_000991058.1.100284 WP_000991058.1.100313 WP_000991058.1.100314 WP_000991058.1.100321 WP_000991058.1.100354 WP_000991058.1.100421 WP_000991058.1.100446 WP_000991058.1.100450 WP_000991058.1.100592 WP_000991058.1.100610 WP_000991058.1.100732 WP_000991058.1.100733 WP_000991058.1.100739 WP_000991058.1.100764 WP_000991058.1.100799 WP_000991058.1.100941 WP_000991058.1.100953 WP_000991058.1.101011 WP_000991058.1.10108 WP_000991058.1.101226 WP_000991058.1.10124 WP_000991058.1.101271 WP_000991058.1.101312 WP_000991058.1.101322 WP_000991058.1.101374 WP_000991058.1.101616 WP_000991058.1.101890 WP_000991058.1.101941 WP_000991058.1.102050 WP_000991058.1.102087 WP_000991058.1.10338 WP_000991058.1.1038 WP_000991058.1.104 WP_000991058.1.10401 WP_000991058.1.10428 WP_000991058.1.10459 WP_000991058.1.10475 WP_000991058.1.10511 WP_000991058.1.10514 WP_000991058.1.10530 WP_000991058.1.10532 WP_000991058.1.10547 WP_000991058.1.10595 WP_000991058.1.10642 WP_000991058.1.10654 WP_000991058.1.10677 WP_000991058.1.10857 WP_000991058.1.10873 WP_000991058.1.10926 WP_000991058.1.10936 WP_000991058.1.11012 WP_000991058.1.11055 WP_000991058.1.11126 WP_000991058.1.11142 WP_000991058.1.11239 WP_000991058.1.11253 WP_000991058.1.11314 WP_000991058.1.11385 WP_000991058.1.1142 WP_000991058.1.11426 WP_000991058.1.11429 WP_000991058.1.11557 WP_000991058.1.11567 WP_000991058.1.11638 WP_000991058.1.11883 WP_000991058.1.11908 WP_000991058.1.11914 WP_000991058.1.12040 WP_000991058.1.12061 WP_000991058.1.1207 WP_000991058.1.12141 WP_000991058.1.12172 WP_000991058.1.12192 WP_000991058.1.1224 WP_000991058.1.12364 WP_000991058.1.12398 WP_000991058.1.12441 WP_000991058.1.12581 WP_000991058.1.12620 WP_000991058.1.12648 WP_000991058.1.12683 WP_000991058.1.12726 WP_000991058.1.12727 WP_000991058.1.12741 WP_000991058.1.12834 WP_000991058.1.13108 WP_000991058.1.13161 WP_000991058.1.1321 WP_000991058.1.13268 WP_000991058.1.13291 WP_000991058.1.133 WP_000991058.1.13314 WP_000991058.1.13342 WP_000991058.1.13352 WP_000991058.1.13406 WP_000991058.1.13440 WP_000991058.1.13443 WP_000991058.1.13476 WP_000991058.1.13599 WP_000991058.1.13686 WP_000991058.1.1372 WP_000991058.1.13732 WP_000991058.1.1382 WP_000991058.1.1397 WP_000991058.1.13972 WP_000991058.1.140 WP_000991058.1.1401 WP_000991058.1.1408 WP_000991058.1.14089 WP_000991058.1.14099 WP_000991058.1.14120 WP_000991058.1.14123 WP_000991058.1.14150 WP_000991058.1.14191 WP_000991058.1.14197 WP_000991058.1.14280 WP_000991058.1.14333 WP_000991058.1.14399 WP_000991058.1.14467 WP_000991058.1.14474 WP_000991058.1.14500 WP_000991058.1.14526 WP_000991058.1.14701 WP_000991058.1.14703 WP_000991058.1.14719 WP_000991058.1.1473 WP_000991058.1.14765 WP_000991058.1.14810 WP_000991058.1.14877 WP_000991058.1.14894 WP_000991058.1.14930 WP_000991058.1.14947 WP_000991058.1.14948 WP_000991058.1.15184 WP_000991058.1.15244 WP_000991058.1.15265 WP_000991058.1.15362 WP_000991058.1.15415 WP_000991058.1.15423 WP_000991058.1.15433 WP_000991058.1.15439 WP_000991058.1.15487 WP_000991058.1.15535 WP_000991058.1.15581 WP_000991058.1.15597 WP_000991058.1.15710 WP_000991058.1.15905 WP_000991058.1.15912 WP_000991058.1.16046 WP_000991058.1.16051 WP_000991058.1.16058 WP_000991058.1.16150 WP_000991058.1.16155 WP_000991058.1.1626 WP_000991058.1.16264 WP_000991058.1.16344 WP_000991058.1.16452 WP_000991058.1.16461 WP_000991058.1.16462 WP_000991058.1.16465 WP_000991058.1.16658 WP_000991058.1.16666 WP_000991058.1.16673 WP_000991058.1.1674 WP_000991058.1.16767 WP_000991058.1.16781 WP_000991058.1.16879 WP_000991058.1.16893 WP_000991058.1.16905 WP_000991058.1.16948 WP_000991058.1.17049 WP_000991058.1.17058 WP_000991058.1.17078 WP_000991058.1.17202 WP_000991058.1.17219 WP_000991058.1.1722 WP_000991058.1.17308 WP_000991058.1.17368 WP_000991058.1.17405 WP_000991058.1.17406 WP_000991058.1.17513 WP_000991058.1.17543 WP_000991058.1.17563 WP_000991058.1.17578 WP_000991058.1.17622 WP_000991058.1.17659 WP_000991058.1.17667 WP_000991058.1.17686 WP_000991058.1.17741 WP_000991058.1.17840 WP_000991058.1.17956 WP_000991058.1.18005 WP_000991058.1.1801 WP_000991058.1.18021 WP_000991058.1.18099 WP_000991058.1.18124 WP_000991058.1.18144 WP_000991058.1.18173 WP_000991058.1.18270 WP_000991058.1.18280 WP_000991058.1.18328 WP_000991058.1.18358 WP_000991058.1.18370 WP_000991058.1.18406 WP_000991058.1.18474 WP_000991058.1.18513 WP_000991058.1.18610 WP_000991058.1.18678 WP_000991058.1.18722 WP_000991058.1.18766 WP_000991058.1.1880 WP_000991058.1.1885 WP_000991058.1.18860 WP_000991058.1.18922 WP_000991058.1.18959 WP_000991058.1.19001 WP_000991058.1.19006 WP_000991058.1.19044 WP_000991058.1.19084 WP_000991058.1.19187 WP_000991058.1.19228 WP_000991058.1.19288 WP_000991058.1.19300 WP_000991058.1.19422 WP_000991058.1.19454 WP_000991058.1.19456 WP_000991058.1.19496 WP_000991058.1.19535 WP_000991058.1.19538 WP_000991058.1.19589 WP_000991058.1.19663 WP_000991058.1.19686 WP_000991058.1.19731 WP_000991058.1.19794 WP_000991058.1.1992 WP_000991058.1.19999 WP_000991058.1.20254 WP_000991058.1.20255 WP_000991058.1.20296 WP_000991058.1.20339 WP_000991058.1.20419 WP_000991058.1.20465 WP_000991058.1.20492 WP_000991058.1.2053 WP_000991058.1.20635 WP_000991058.1.20718 WP_000991058.1.2073 WP_000991058.1.20740 WP_000991058.1.20828 WP_000991058.1.2087 WP_000991058.1.20883 WP_000991058.1.20947 WP_000991058.1.20953 WP_000991058.1.21010 WP_000991058.1.2106 WP_000991058.1.21062 WP_000991058.1.21144 WP_000991058.1.21162 WP_000991058.1.21184 WP_000991058.1.21185 WP_000991058.1.21366 WP_000991058.1.21492 WP_000991058.1.21674 WP_000991058.1.21946 WP_000991058.1.21966 WP_000991058.1.22064 WP_000991058.1.22118 WP_000991058.1.22126 WP_000991058.1.2216 WP_000991058.1.22208 WP_000991058.1.2227 WP_000991058.1.22373 WP_000991058.1.22476 WP_000991058.1.22614 WP_000991058.1.22652 WP_000991058.1.22683 WP_000991058.1.2284 WP_000991058.1.22895 WP_000991058.1.22926 WP_000991058.1.22943 WP_000991058.1.22967 WP_000991058.1.23040 WP_000991058.1.23058 WP_000991058.1.23218 WP_000991058.1.2331 WP_000991058.1.2332 WP_000991058.1.23340 WP_000991058.1.2336 WP_000991058.1.23365 WP_000991058.1.23412 WP_000991058.1.23426 WP_000991058.1.23492 WP_000991058.1.23515 WP_000991058.1.23548 WP_000991058.1.23571 WP_000991058.1.23604 WP_000991058.1.23679 WP_000991058.1.23728 WP_000991058.1.2375 WP_000991058.1.23783 WP_000991058.1.23786 WP_000991058.1.23787 WP_000991058.1.23801 WP_000991058.1.24028 WP_000991058.1.24061 WP_000991058.1.24083 WP_000991058.1.24117 WP_000991058.1.24125 WP_000991058.1.24138 WP_000991058.1.24153 WP_000991058.1.24291 WP_000991058.1.24322 WP_000991058.1.24355 WP_000991058.1.24375 WP_000991058.1.24400 WP_000991058.1.24619 WP_000991058.1.24643 WP_000991058.1.24688 WP_000991058.1.24716 WP_000991058.1.2481 WP_000991058.1.24964 WP_000991058.1.25017 WP_000991058.1.25032 WP_000991058.1.25041 WP_000991058.1.25053 WP_000991058.1.25185 WP_000991058.1.25196 WP_000991058.1.25210 WP_000991058.1.25219 WP_000991058.1.25304 WP_000991058.1.25374 WP_000991058.1.25475 WP_000991058.1.25490 WP_000991058.1.25508 WP_000991058.1.25512 WP_000991058.1.25603 WP_000991058.1.2562 WP_000991058.1.25666 WP_000991058.1.25807 WP_000991058.1.25821 WP_000991058.1.25833 WP_000991058.1.25835 WP_000991058.1.25882 WP_000991058.1.25911 WP_000991058.1.25962 WP_000991058.1.25963 WP_000991058.1.26001 WP_000991058.1.26027 WP_000991058.1.26107 WP_000991058.1.2615 WP_000991058.1.26217 WP_000991058.1.26230 WP_000991058.1.26232 WP_000991058.1.26272 WP_000991058.1.26286 WP_000991058.1.26288 WP_000991058.1.26394 WP_000991058.1.26491 WP_000991058.1.2654 WP_000991058.1.26554 WP_000991058.1.26636 WP_000991058.1.26689 WP_000991058.1.2679 WP_000991058.1.26908 WP_000991058.1.2692 WP_000991058.1.26928 WP_000991058.1.270 WP_000991058.1.27008 WP_000991058.1.27027 WP_000991058.1.27070 WP_000991058.1.27077 WP_000991058.1.27086 WP_000991058.1.27087 WP_000991058.1.27111 WP_000991058.1.27115 WP_000991058.1.2713 WP_000991058.1.2717 WP_000991058.1.27228 WP_000991058.1.27282 WP_000991058.1.27285 WP_000991058.1.27309 WP_000991058.1.27329 WP_000991058.1.27361 WP_000991058.1.27565 WP_000991058.1.27595 WP_000991058.1.27598 WP_000991058.1.27706 WP_000991058.1.27775 WP_000991058.1.27785 WP_000991058.1.27900 WP_000991058.1.27928 WP_000991058.1.27945 WP_000991058.1.28004 WP_000991058.1.2809 WP_000991058.1.28155 WP_000991058.1.28198 WP_000991058.1.2822 WP_000991058.1.28229 WP_000991058.1.28384 WP_000991058.1.28386 WP_000991058.1.28395 WP_000991058.1.284 WP_000991058.1.2845 WP_000991058.1.28479 WP_000991058.1.28627 WP_000991058.1.28692 WP_000991058.1.2873 WP_000991058.1.28917 WP_000991058.1.28962 WP_000991058.1.29023 WP_000991058.1.29042 WP_000991058.1.2905 WP_000991058.1.2907 WP_000991058.1.29081 WP_000991058.1.29089 WP_000991058.1.29153 WP_000991058.1.29203 WP_000991058.1.29237 WP_000991058.1.29248 WP_000991058.1.29288 WP_000991058.1.29389 WP_000991058.1.2946 WP_000991058.1.29462 WP_000991058.1.29563 WP_000991058.1.29727 WP_000991058.1.29743 WP_000991058.1.29782 WP_000991058.1.29833 WP_000991058.1.29851 WP_000991058.1.29865 WP_000991058.1.29886 WP_000991058.1.29919 WP_000991058.1.2994 WP_000991058.1.29964 WP_000991058.1.29983 WP_000991058.1.30009 WP_000991058.1.30013 WP_000991058.1.3002 WP_000991058.1.30034 WP_000991058.1.30049 WP_000991058.1.30058 WP_000991058.1.30172 WP_000991058.1.30185 WP_000991058.1.30354 WP_000991058.1.30357 WP_000991058.1.30362 WP_000991058.1.3042 WP_000991058.1.30421 WP_000991058.1.30440 WP_000991058.1.30448 WP_000991058.1.30489 WP_000991058.1.30517 WP_000991058.1.30542 WP_000991058.1.30544 WP_000991058.1.30556 WP_000991058.1.30572 WP_000991058.1.30585 WP_000991058.1.30618 WP_000991058.1.30664 WP_000991058.1.30688 WP_000991058.1.30806 WP_000991058.1.30967 WP_000991058.1.31046 WP_000991058.1.31066 WP_000991058.1.31078 WP_000991058.1.31139 WP_000991058.1.31145 WP_000991058.1.31182 WP_000991058.1.31205 WP_000991058.1.3121 WP_000991058.1.31223 WP_000991058.1.31303 WP_000991058.1.3131 WP_000991058.1.31352 WP_000991058.1.31389 WP_000991058.1.31413 WP_000991058.1.31446 WP_000991058.1.31533 WP_000991058.1.31799 WP_000991058.1.31836 WP_000991058.1.31951 WP_000991058.1.32041 WP_000991058.1.32042 WP_000991058.1.3207 WP_000991058.1.32189 WP_000991058.1.32202 WP_000991058.1.32263 WP_000991058.1.32293 WP_000991058.1.32299 WP_000991058.1.32422 WP_000991058.1.32425 WP_000991058.1.32458 WP_000991058.1.32460 WP_000991058.1.32529 WP_000991058.1.32563 WP_000991058.1.32578 WP_000991058.1.32617 WP_000991058.1.3270 WP_000991058.1.32725 WP_000991058.1.32838 WP_000991058.1.32848 WP_000991058.1.32868 WP_000991058.1.3290 WP_000991058.1.32940 WP_000991058.1.32941 WP_000991058.1.3296 WP_000991058.1.32966 WP_000991058.1.32985 WP_000991058.1.33037 WP_000991058.1.3305 WP_000991058.1.33051 WP_000991058.1.33065 WP_000991058.1.33122 WP_000991058.1.3315 WP_000991058.1.33208 WP_000991058.1.33214 WP_000991058.1.33247 WP_000991058.1.33280 WP_000991058.1.33283 WP_000991058.1.33313 WP_000991058.1.33339 WP_000991058.1.33382 WP_000991058.1.33490 WP_000991058.1.33501 WP_000991058.1.33529 WP_000991058.1.33689 WP_000991058.1.3370 WP_000991058.1.33730 WP_000991058.1.33741 WP_000991058.1.33840 WP_000991058.1.3392 WP_000991058.1.33926 WP_000991058.1.33957 WP_000991058.1.33969 WP_000991058.1.34001 WP_000991058.1.34059 WP_000991058.1.34118 WP_000991058.1.34211 WP_000991058.1.34214 WP_000991058.1.34234 WP_000991058.1.34284 WP_000991058.1.34376 WP_000991058.1.34382 WP_000991058.1.34484 WP_000991058.1.34517 WP_000991058.1.34530 WP_000991058.1.34665 WP_000991058.1.34694 WP_000991058.1.34751 WP_000991058.1.34808 WP_000991058.1.34824 WP_000991058.1.34834 WP_000991058.1.34932 WP_000991058.1.34962 WP_000991058.1.35001 WP_000991058.1.35040 WP_000991058.1.35074 WP_000991058.1.35175 WP_000991058.1.35240 WP_000991058.1.35274 WP_000991058.1.35532 WP_000991058.1.35560 WP_000991058.1.3557 WP_000991058.1.35628 WP_000991058.1.3570 WP_000991058.1.35712 WP_000991058.1.35713 WP_000991058.1.35736 WP_000991058.1.35791 WP_000991058.1.35795 WP_000991058.1.35870 WP_000991058.1.35916 WP_000991058.1.35938 WP_000991058.1.35966 WP_000991058.1.36000 WP_000991058.1.36034 WP_000991058.1.36036 WP_000991058.1.36069 WP_000991058.1.36291 WP_000991058.1.36298 WP_000991058.1.36308 WP_000991058.1.36323 WP_000991058.1.36343 WP_000991058.1.36460 WP_000991058.1.3649 WP_000991058.1.36495 WP_000991058.1.36526 WP_000991058.1.36567 WP_000991058.1.36579 WP_000991058.1.36617 WP_000991058.1.36618 WP_000991058.1.36643 WP_000991058.1.36663 WP_000991058.1.36701 WP_000991058.1.36725 WP_000991058.1.36779 WP_000991058.1.36798 WP_000991058.1.36802 WP_000991058.1.36821 WP_000991058.1.36853 WP_000991058.1.36950 WP_000991058.1.37014 WP_000991058.1.37133 WP_000991058.1.37176 WP_000991058.1.37199 WP_000991058.1.37200 WP_000991058.1.37258 WP_000991058.1.37303 WP_000991058.1.37513 WP_000991058.1.37584 WP_000991058.1.37590 WP_000991058.1.37593 WP_000991058.1.37600 WP_000991058.1.37613 WP_000991058.1.37659 WP_000991058.1.37662 WP_000991058.1.37675 WP_000991058.1.37691 WP_000991058.1.37761 WP_000991058.1.37775 WP_000991058.1.37777 WP_000991058.1.378 WP_000991058.1.379 WP_000991058.1.37911 WP_000991058.1.37941 WP_000991058.1.37985 WP_000991058.1.38061 WP_000991058.1.38064 WP_000991058.1.38108 WP_000991058.1.3816 WP_000991058.1.38207 WP_000991058.1.38261 WP_000991058.1.38266 WP_000991058.1.38310 WP_000991058.1.3834 WP_000991058.1.38351 WP_000991058.1.3838 WP_000991058.1.38381 WP_000991058.1.38440 WP_000991058.1.38486 WP_000991058.1.38515 WP_000991058.1.38595 WP_000991058.1.3860 WP_000991058.1.38642 WP_000991058.1.38734 WP_000991058.1.38877 WP_000991058.1.38983 WP_000991058.1.38996 WP_000991058.1.39056 WP_000991058.1.3907 WP_000991058.1.39105 WP_000991058.1.3914 WP_000991058.1.39147 WP_000991058.1.39161 WP_000991058.1.39210 WP_000991058.1.39235 WP_000991058.1.3931 WP_000991058.1.39435 WP_000991058.1.39502 WP_000991058.1.39530 WP_000991058.1.39619 WP_000991058.1.39620 WP_000991058.1.39624 WP_000991058.1.39659 WP_000991058.1.39667 WP_000991058.1.39775 WP_000991058.1.39879 WP_000991058.1.39890 WP_000991058.1.39941 WP_000991058.1.39945 WP_000991058.1.39947 WP_000991058.1.40095 WP_000991058.1.40097 WP_000991058.1.401 WP_000991058.1.40160 WP_000991058.1.40167 WP_000991058.1.40279 WP_000991058.1.40361 WP_000991058.1.4042 WP_000991058.1.40467 WP_000991058.1.40496 WP_000991058.1.40517 WP_000991058.1.40698 WP_000991058.1.40750 WP_000991058.1.40763 WP_000991058.1.40854 WP_000991058.1.4089 WP_000991058.1.40924 WP_000991058.1.40932 WP_000991058.1.40946 WP_000991058.1.41004 WP_000991058.1.4106 WP_000991058.1.41070 WP_000991058.1.41074 WP_000991058.1.41075 WP_000991058.1.41097 WP_000991058.1.41132 WP_000991058.1.41176 WP_000991058.1.41251 WP_000991058.1.41258 WP_000991058.1.41305 WP_000991058.1.41321 WP_000991058.1.41333 WP_000991058.1.41335 WP_000991058.1.4136 WP_000991058.1.41415 WP_000991058.1.41459 WP_000991058.1.41498 WP_000991058.1.41519 WP_000991058.1.41524 WP_000991058.1.41631 WP_000991058.1.41658 WP_000991058.1.41659 WP_000991058.1.41716 WP_000991058.1.41746 WP_000991058.1.41824 WP_000991058.1.41825 WP_000991058.1.41836 WP_000991058.1.41894 WP_000991058.1.41919 WP_000991058.1.41929 WP_000991058.1.4194 WP_000991058.1.42069 WP_000991058.1.42081 WP_000991058.1.42090 WP_000991058.1.42111 WP_000991058.1.42187 WP_000991058.1.42200 WP_000991058.1.42219 WP_000991058.1.42257 WP_000991058.1.42261 WP_000991058.1.42349 WP_000991058.1.42364 WP_000991058.1.42371 WP_000991058.1.42379 WP_000991058.1.42391 WP_000991058.1.42399 WP_000991058.1.42539 WP_000991058.1.42603 WP_000991058.1.42650 WP_000991058.1.4267 WP_000991058.1.42701 WP_000991058.1.42805 WP_000991058.1.42815 WP_000991058.1.42859 WP_000991058.1.4298 WP_000991058.1.43008 WP_000991058.1.43016 WP_000991058.1.43019 WP_000991058.1.43065 WP_000991058.1.43068 WP_000991058.1.43069 WP_000991058.1.43128 WP_000991058.1.43141 WP_000991058.1.43157 WP_000991058.1.43161 WP_000991058.1.43190 WP_000991058.1.43198 WP_000991058.1.4326 WP_000991058.1.43290 WP_000991058.1.43292 WP_000991058.1.43307 WP_000991058.1.43513 WP_000991058.1.43633 WP_000991058.1.43637 WP_000991058.1.43651 WP_000991058.1.43722 WP_000991058.1.43801 WP_000991058.1.43812 WP_000991058.1.43878 WP_000991058.1.43888 WP_000991058.1.43919 WP_000991058.1.43974 WP_000991058.1.44049 WP_000991058.1.44101 WP_000991058.1.44160 WP_000991058.1.44180 WP_000991058.1.44196 WP_000991058.1.44248 WP_000991058.1.44262 WP_000991058.1.44268 WP_000991058.1.4427 WP_000991058.1.44296 WP_000991058.1.44351 WP_000991058.1.44360 WP_000991058.1.44416 WP_000991058.1.44431 WP_000991058.1.44437 WP_000991058.1.44546 WP_000991058.1.4468 WP_000991058.1.44762 WP_000991058.1.44815 WP_000991058.1.44828 WP_000991058.1.44879 WP_000991058.1.44917 WP_000991058.1.4501 WP_000991058.1.45072 WP_000991058.1.45093 WP_000991058.1.45136 WP_000991058.1.45241 WP_000991058.1.45435 WP_000991058.1.45523 WP_000991058.1.45596 WP_000991058.1.45648 WP_000991058.1.45829 WP_000991058.1.45871 WP_000991058.1.46030 WP_000991058.1.46077 WP_000991058.1.46169 WP_000991058.1.46225 WP_000991058.1.46241 WP_000991058.1.46307 WP_000991058.1.46355 WP_000991058.1.464 WP_000991058.1.46454 WP_000991058.1.46504 WP_000991058.1.46505 WP_000991058.1.46559 WP_000991058.1.46701 WP_000991058.1.46781 WP_000991058.1.46816 WP_000991058.1.46842 WP_000991058.1.4690 WP_000991058.1.46920 WP_000991058.1.46945 WP_000991058.1.47036 WP_000991058.1.47037 WP_000991058.1.47042 WP_000991058.1.47059 WP_000991058.1.47085 WP_000991058.1.47123 WP_000991058.1.47215 WP_000991058.1.47245 WP_000991058.1.47523 WP_000991058.1.47531 WP_000991058.1.47532 WP_000991058.1.47605 WP_000991058.1.47630 WP_000991058.1.4774 WP_000991058.1.47756 WP_000991058.1.4781 WP_000991058.1.47886 WP_000991058.1.47898 WP_000991058.1.48019 WP_000991058.1.48100 WP_000991058.1.48114 WP_000991058.1.48139 WP_000991058.1.48190 WP_000991058.1.48292 WP_000991058.1.48324 WP_000991058.1.48426 WP_000991058.1.48430 WP_000991058.1.48436 WP_000991058.1.48586 WP_000991058.1.4859 WP_000991058.1.48591 WP_000991058.1.48610 WP_000991058.1.48631 WP_000991058.1.48663 WP_000991058.1.48734 WP_000991058.1.48756 WP_000991058.1.48778 WP_000991058.1.48849 WP_000991058.1.48955 WP_000991058.1.48963 WP_000991058.1.48973 WP_000991058.1.49004 WP_000991058.1.49106 WP_000991058.1.49117 WP_000991058.1.49121 WP_000991058.1.4914 WP_000991058.1.49140 WP_000991058.1.49153 WP_000991058.1.49355 WP_000991058.1.49429 WP_000991058.1.49434 WP_000991058.1.49450 WP_000991058.1.495 WP_000991058.1.49545 WP_000991058.1.49703 WP_000991058.1.49769 WP_000991058.1.49846 WP_000991058.1.4991 WP_000991058.1.49947 WP_000991058.1.49959 WP_000991058.1.49997 WP_000991058.1.50014 WP_000991058.1.50030 WP_000991058.1.50043 WP_000991058.1.50103 WP_000991058.1.50158 WP_000991058.1.50247 WP_000991058.1.50308 WP_000991058.1.50309 WP_000991058.1.50387 WP_000991058.1.50406 WP_000991058.1.50468 WP_000991058.1.5051 WP_000991058.1.50566 WP_000991058.1.50570 WP_000991058.1.50626 WP_000991058.1.50726 WP_000991058.1.50771 WP_000991058.1.50875 WP_000991058.1.50885 WP_000991058.1.509 WP_000991058.1.50929 WP_000991058.1.50970 WP_000991058.1.51040 WP_000991058.1.51048 WP_000991058.1.51100 WP_000991058.1.51134 WP_000991058.1.51227 WP_000991058.1.5127 WP_000991058.1.51305 WP_000991058.1.51315 WP_000991058.1.5136 WP_000991058.1.51474 WP_000991058.1.51519 WP_000991058.1.51598 WP_000991058.1.51644 WP_000991058.1.51724 WP_000991058.1.51734 WP_000991058.1.51838 WP_000991058.1.51863 WP_000991058.1.51935 WP_000991058.1.52057 WP_000991058.1.52114 WP_000991058.1.52129 WP_000991058.1.52191 WP_000991058.1.52202 WP_000991058.1.52209 WP_000991058.1.52339 WP_000991058.1.52469 WP_000991058.1.52571 WP_000991058.1.526 WP_000991058.1.52647 WP_000991058.1.52742 WP_000991058.1.52773 WP_000991058.1.52795 WP_000991058.1.52807 WP_000991058.1.52887 WP_000991058.1.53092 WP_000991058.1.53141 WP_000991058.1.53151 WP_000991058.1.53154 WP_000991058.1.53159 WP_000991058.1.53210 WP_000991058.1.53233 WP_000991058.1.53307 WP_000991058.1.53321 WP_000991058.1.53368 WP_000991058.1.53375 WP_000991058.1.53450 WP_000991058.1.5349 WP_000991058.1.53540 WP_000991058.1.53555 WP_000991058.1.53559 WP_000991058.1.5356 WP_000991058.1.53571 WP_000991058.1.5358 WP_000991058.1.53723 WP_000991058.1.5374 WP_000991058.1.53750 WP_000991058.1.53800 WP_000991058.1.53815 WP_000991058.1.53839 WP_000991058.1.53892 WP_000991058.1.53898 WP_000991058.1.53902 WP_000991058.1.53958 WP_000991058.1.53981 WP_000991058.1.53984 WP_000991058.1.54132 WP_000991058.1.54170 WP_000991058.1.54175 WP_000991058.1.54203 WP_000991058.1.54259 WP_000991058.1.5430 WP_000991058.1.54371 WP_000991058.1.54431 WP_000991058.1.54442 WP_000991058.1.54482 WP_000991058.1.54589 WP_000991058.1.54667 WP_000991058.1.54678 WP_000991058.1.54681 WP_000991058.1.54748 WP_000991058.1.5481 WP_000991058.1.54865 WP_000991058.1.54935 WP_000991058.1.54979 WP_000991058.1.55010 WP_000991058.1.55034 WP_000991058.1.55163 WP_000991058.1.55165 WP_000991058.1.55215 WP_000991058.1.55310 WP_000991058.1.55317 WP_000991058.1.55379 WP_000991058.1.5539 WP_000991058.1.55468 WP_000991058.1.55506 WP_000991058.1.55604 WP_000991058.1.55639 WP_000991058.1.55699 WP_000991058.1.55725 WP_000991058.1.55780 WP_000991058.1.55967 WP_000991058.1.56144 WP_000991058.1.56172 WP_000991058.1.5621 WP_000991058.1.56226 WP_000991058.1.56311 WP_000991058.1.56419 WP_000991058.1.56423 WP_000991058.1.56514 WP_000991058.1.56535 WP_000991058.1.56640 WP_000991058.1.56724 WP_000991058.1.56825 WP_000991058.1.56887 WP_000991058.1.56889 WP_000991058.1.56981 WP_000991058.1.57101 WP_000991058.1.57137 WP_000991058.1.57147 WP_000991058.1.57179 WP_000991058.1.57186 WP_000991058.1.57342 WP_000991058.1.57684 WP_000991058.1.57699 WP_000991058.1.57785 WP_000991058.1.57800 WP_000991058.1.57873 WP_000991058.1.57965 WP_000991058.1.57972 WP_000991058.1.58008 WP_000991058.1.58044 WP_000991058.1.58081 WP_000991058.1.5809 WP_000991058.1.58132 WP_000991058.1.58173 WP_000991058.1.58191 WP_000991058.1.58194 WP_000991058.1.58252 WP_000991058.1.58261 WP_000991058.1.58274 WP_000991058.1.58324 WP_000991058.1.58326 WP_000991058.1.5836 WP_000991058.1.58485 WP_000991058.1.58537 WP_000991058.1.58568 WP_000991058.1.58583 WP_000991058.1.58652 WP_000991058.1.58663 WP_000991058.1.58724 WP_000991058.1.5875 WP_000991058.1.58796 WP_000991058.1.58807 WP_000991058.1.58847 WP_000991058.1.58883 WP_000991058.1.58898 WP_000991058.1.58949 WP_000991058.1.58963 WP_000991058.1.58970 WP_000991058.1.59020 WP_000991058.1.59043 WP_000991058.1.59056 WP_000991058.1.59061 WP_000991058.1.59064 WP_000991058.1.59282 WP_000991058.1.59299 WP_000991058.1.59313 WP_000991058.1.5949 WP_000991058.1.59501 WP_000991058.1.59510 WP_000991058.1.5969 WP_000991058.1.59751 WP_000991058.1.59827 WP_000991058.1.59829 WP_000991058.1.59847 WP_000991058.1.59863 WP_000991058.1.59969 WP_000991058.1.59994 WP_000991058.1.60045 WP_000991058.1.60076 WP_000991058.1.60114 WP_000991058.1.60154 WP_000991058.1.60168 WP_000991058.1.60192 WP_000991058.1.60199 WP_000991058.1.60212 WP_000991058.1.60253 WP_000991058.1.60322 WP_000991058.1.60324 WP_000991058.1.60356 WP_000991058.1.6038 WP_000991058.1.60380 WP_000991058.1.6041 WP_000991058.1.60424 WP_000991058.1.60481 WP_000991058.1.605 WP_000991058.1.6058 WP_000991058.1.60584 WP_000991058.1.6060 WP_000991058.1.60676 WP_000991058.1.60708 WP_000991058.1.60725 WP_000991058.1.60783 WP_000991058.1.60792 WP_000991058.1.60807 WP_000991058.1.60882 WP_000991058.1.60889 WP_000991058.1.60950 WP_000991058.1.6104 WP_000991058.1.61044 WP_000991058.1.61076 WP_000991058.1.61123 WP_000991058.1.61147 WP_000991058.1.61168 WP_000991058.1.61210 WP_000991058.1.61357 WP_000991058.1.61511 WP_000991058.1.61539 WP_000991058.1.61542 WP_000991058.1.61553 WP_000991058.1.61649 WP_000991058.1.61652 WP_000991058.1.61697 WP_000991058.1.61809 WP_000991058.1.61877 WP_000991058.1.61920 WP_000991058.1.62124 WP_000991058.1.62199 WP_000991058.1.62223 WP_000991058.1.62302 WP_000991058.1.62314 WP_000991058.1.62323 WP_000991058.1.62333 WP_000991058.1.62338 WP_000991058.1.62380 WP_000991058.1.62411 WP_000991058.1.62436 WP_000991058.1.62475 WP_000991058.1.62536 WP_000991058.1.62640 WP_000991058.1.62686 WP_000991058.1.62751 WP_000991058.1.62825 WP_000991058.1.62913 WP_000991058.1.62932 WP_000991058.1.63016 WP_000991058.1.63025 WP_000991058.1.63069 WP_000991058.1.63087 WP_000991058.1.63297 WP_000991058.1.63448 WP_000991058.1.63514 WP_000991058.1.63583 WP_000991058.1.63592 WP_000991058.1.63663 WP_000991058.1.63736 WP_000991058.1.63816 WP_000991058.1.63876 WP_000991058.1.6389 WP_000991058.1.63901 WP_000991058.1.63955 WP_000991058.1.63963 WP_000991058.1.64032 WP_000991058.1.64087 WP_000991058.1.6415 WP_000991058.1.64293 WP_000991058.1.64332 WP_000991058.1.64376 WP_000991058.1.644 WP_000991058.1.64471 WP_000991058.1.64501 WP_000991058.1.64538 WP_000991058.1.64632 WP_000991058.1.64648 WP_000991058.1.64654 WP_000991058.1.64662 WP_000991058.1.64663 WP_000991058.1.64709 WP_000991058.1.64710 WP_000991058.1.64744 WP_000991058.1.64763 WP_000991058.1.64817 WP_000991058.1.64847 WP_000991058.1.6487 WP_000991058.1.64891 WP_000991058.1.64974 WP_000991058.1.65054 WP_000991058.1.65075 WP_000991058.1.6514 WP_000991058.1.65172 WP_000991058.1.65200 WP_000991058.1.65218 WP_000991058.1.65226 WP_000991058.1.65249 WP_000991058.1.65266 WP_000991058.1.65395 WP_000991058.1.65459 WP_000991058.1.65463 WP_000991058.1.65487 WP_000991058.1.6549 WP_000991058.1.65499 WP_000991058.1.6554 WP_000991058.1.65650 WP_000991058.1.65697 WP_000991058.1.65699 WP_000991058.1.65737 WP_000991058.1.65755 WP_000991058.1.65812 WP_000991058.1.65846 WP_000991058.1.65863 WP_000991058.1.65985 WP_000991058.1.66021 WP_000991058.1.66031 WP_000991058.1.66052 WP_000991058.1.66064 WP_000991058.1.66109 WP_000991058.1.66145 WP_000991058.1.66183 WP_000991058.1.66216 WP_000991058.1.66234 WP_000991058.1.66324 WP_000991058.1.6634 WP_000991058.1.66361 WP_000991058.1.66480 WP_000991058.1.66506 WP_000991058.1.66665 WP_000991058.1.66681 WP_000991058.1.66684 WP_000991058.1.66755 WP_000991058.1.66759 WP_000991058.1.66801 WP_000991058.1.66860 WP_000991058.1.66953 WP_000991058.1.66955 WP_000991058.1.66981 WP_000991058.1.67024 WP_000991058.1.67042 WP_000991058.1.67101 WP_000991058.1.67143 WP_000991058.1.67201 WP_000991058.1.67211 WP_000991058.1.67237 WP_000991058.1.67336 WP_000991058.1.67387 WP_000991058.1.67394 WP_000991058.1.67397 WP_000991058.1.67403 WP_000991058.1.67430 WP_000991058.1.67442 WP_000991058.1.67539 WP_000991058.1.67556 WP_000991058.1.67576 WP_000991058.1.67604 WP_000991058.1.67619 WP_000991058.1.67625 WP_000991058.1.67627 WP_000991058.1.67641 WP_000991058.1.67657 WP_000991058.1.67673 WP_000991058.1.67700 WP_000991058.1.67718 WP_000991058.1.67729 WP_000991058.1.67774 WP_000991058.1.67820 WP_000991058.1.67910 WP_000991058.1.67954 WP_000991058.1.68 WP_000991058.1.68043 WP_000991058.1.68105 WP_000991058.1.68113 WP_000991058.1.68131 WP_000991058.1.68182 WP_000991058.1.6819 WP_000991058.1.68285 WP_000991058.1.68359 WP_000991058.1.68420 WP_000991058.1.68514 WP_000991058.1.68564 WP_000991058.1.68688 WP_000991058.1.68742 WP_000991058.1.68809 WP_000991058.1.68914 WP_000991058.1.69053 WP_000991058.1.69170 WP_000991058.1.69210 WP_000991058.1.69270 WP_000991058.1.69282 WP_000991058.1.69376 WP_000991058.1.69396 WP_000991058.1.69466 WP_000991058.1.69611 WP_000991058.1.69642 WP_000991058.1.69656 WP_000991058.1.69657 WP_000991058.1.69690 WP_000991058.1.69923 WP_000991058.1.69948 WP_000991058.1.69953 WP_000991058.1.70010 WP_000991058.1.70049 WP_000991058.1.70058 WP_000991058.1.70061 WP_000991058.1.70205 WP_000991058.1.70240 WP_000991058.1.70249 WP_000991058.1.70261 WP_000991058.1.70314 WP_000991058.1.7033 WP_000991058.1.70427 WP_000991058.1.70433 WP_000991058.1.70545 WP_000991058.1.70623 WP_000991058.1.70671 WP_000991058.1.70679 WP_000991058.1.70708 WP_000991058.1.70717 WP_000991058.1.70731 WP_000991058.1.70772 WP_000991058.1.70845 WP_000991058.1.70981 WP_000991058.1.71039 WP_000991058.1.71057 WP_000991058.1.71081 WP_000991058.1.71117 WP_000991058.1.71186 WP_000991058.1.71455 WP_000991058.1.71456 WP_000991058.1.71487 WP_000991058.1.71523 WP_000991058.1.71542 WP_000991058.1.71566 WP_000991058.1.71640 WP_000991058.1.71651 WP_000991058.1.71653 WP_000991058.1.71716 WP_000991058.1.71872 WP_000991058.1.71950 WP_000991058.1.71954 WP_000991058.1.71985 WP_000991058.1.72003 WP_000991058.1.72073 WP_000991058.1.72269 WP_000991058.1.72350 WP_000991058.1.72383 WP_000991058.1.72461 WP_000991058.1.72527 WP_000991058.1.7255 WP_000991058.1.72631 WP_000991058.1.72638 WP_000991058.1.72667 WP_000991058.1.72674 WP_000991058.1.72724 WP_000991058.1.72789 WP_000991058.1.72828 WP_000991058.1.72896 WP_000991058.1.72969 WP_000991058.1.72987 WP_000991058.1.73052 WP_000991058.1.7311 WP_000991058.1.73114 WP_000991058.1.73177 WP_000991058.1.73180 WP_000991058.1.73258 WP_000991058.1.73285 WP_000991058.1.7332 WP_000991058.1.7333 WP_000991058.1.73352 WP_000991058.1.73389 WP_000991058.1.73425 WP_000991058.1.73488 WP_000991058.1.73504 WP_000991058.1.7353 WP_000991058.1.73544 WP_000991058.1.73598 WP_000991058.1.7361 WP_000991058.1.73648 WP_000991058.1.73768 WP_000991058.1.73849 WP_000991058.1.73948 WP_000991058.1.73999 WP_000991058.1.74024 WP_000991058.1.74030 WP_000991058.1.74038 WP_000991058.1.74043 WP_000991058.1.74058 WP_000991058.1.74070 WP_000991058.1.74077 WP_000991058.1.74135 WP_000991058.1.74214 WP_000991058.1.74241 WP_000991058.1.74285 WP_000991058.1.7430 WP_000991058.1.74317 WP_000991058.1.74415 WP_000991058.1.74616 WP_000991058.1.74621 WP_000991058.1.74647 WP_000991058.1.74677 WP_000991058.1.74831 WP_000991058.1.74894 WP_000991058.1.74929 WP_000991058.1.74939 WP_000991058.1.74973 WP_000991058.1.7507 WP_000991058.1.75089 WP_000991058.1.75116 WP_000991058.1.75237 WP_000991058.1.75273 WP_000991058.1.75296 WP_000991058.1.75413 WP_000991058.1.75433 WP_000991058.1.75532 WP_000991058.1.75565 WP_000991058.1.75593 WP_000991058.1.75610 WP_000991058.1.75633 WP_000991058.1.75718 WP_000991058.1.75745 WP_000991058.1.75844 WP_000991058.1.75886 WP_000991058.1.75898 WP_000991058.1.76081 WP_000991058.1.76116 WP_000991058.1.76122 WP_000991058.1.76339 WP_000991058.1.76366 WP_000991058.1.76417 WP_000991058.1.7646 WP_000991058.1.76510 WP_000991058.1.76558 WP_000991058.1.76572 WP_000991058.1.76641 WP_000991058.1.76651 WP_000991058.1.76653 WP_000991058.1.76788 WP_000991058.1.76854 WP_000991058.1.76916 WP_000991058.1.76932 WP_000991058.1.76973 WP_000991058.1.76988 WP_000991058.1.77016 WP_000991058.1.77087 WP_000991058.1.77090 WP_000991058.1.77111 WP_000991058.1.77299 WP_000991058.1.77384 WP_000991058.1.77501 WP_000991058.1.77513 WP_000991058.1.77563 WP_000991058.1.77702 WP_000991058.1.77713 WP_000991058.1.7772 WP_000991058.1.77825 WP_000991058.1.77837 WP_000991058.1.77900 WP_000991058.1.77923 WP_000991058.1.77975 WP_000991058.1.78035 WP_000991058.1.78048 WP_000991058.1.78107 WP_000991058.1.78166 WP_000991058.1.78192 WP_000991058.1.78195 WP_000991058.1.78291 WP_000991058.1.78309 WP_000991058.1.78320 WP_000991058.1.78382 WP_000991058.1.78388 WP_000991058.1.78410 WP_000991058.1.7862 WP_000991058.1.78626 WP_000991058.1.78661 WP_000991058.1.78674 WP_000991058.1.78676 WP_000991058.1.78761 WP_000991058.1.789 WP_000991058.1.78993 WP_000991058.1.79012 WP_000991058.1.79069 WP_000991058.1.79074 WP_000991058.1.79098 WP_000991058.1.79155 WP_000991058.1.79164 WP_000991058.1.79204 WP_000991058.1.79280 WP_000991058.1.79397 WP_000991058.1.79456 WP_000991058.1.79532 WP_000991058.1.79547 WP_000991058.1.79654 WP_000991058.1.7970 WP_000991058.1.79722 WP_000991058.1.79772 WP_000991058.1.79880 WP_000991058.1.79916 WP_000991058.1.80065 WP_000991058.1.80103 WP_000991058.1.80273 WP_000991058.1.80282 WP_000991058.1.80354 WP_000991058.1.80368 WP_000991058.1.80386 WP_000991058.1.80400 WP_000991058.1.80462 WP_000991058.1.8049 WP_000991058.1.80492 WP_000991058.1.80569 WP_000991058.1.80664 WP_000991058.1.80696 WP_000991058.1.80984 WP_000991058.1.81131 WP_000991058.1.81187 WP_000991058.1.81262 WP_000991058.1.81268 WP_000991058.1.81269 WP_000991058.1.81271 WP_000991058.1.8131 WP_000991058.1.81333 WP_000991058.1.81342 WP_000991058.1.81364 WP_000991058.1.81494 WP_000991058.1.81557 WP_000991058.1.81676 WP_000991058.1.81681 WP_000991058.1.8170 WP_000991058.1.81763 WP_000991058.1.81855 WP_000991058.1.81921 WP_000991058.1.81931 WP_000991058.1.81936 WP_000991058.1.81949 WP_000991058.1.82070 WP_000991058.1.82076 WP_000991058.1.82131 WP_000991058.1.82156 WP_000991058.1.8218 WP_000991058.1.82180 WP_000991058.1.82201 WP_000991058.1.82214 WP_000991058.1.82225 WP_000991058.1.8240 WP_000991058.1.82408 WP_000991058.1.82416 WP_000991058.1.8242 WP_000991058.1.82456 WP_000991058.1.82465 WP_000991058.1.82473 WP_000991058.1.82553 WP_000991058.1.82646 WP_000991058.1.82670 WP_000991058.1.82731 WP_000991058.1.82812 WP_000991058.1.82850 WP_000991058.1.82872 WP_000991058.1.8294 WP_000991058.1.82959 WP_000991058.1.83007 WP_000991058.1.8304 WP_000991058.1.83180 WP_000991058.1.83229 WP_000991058.1.83235 WP_000991058.1.83290 WP_000991058.1.83333 WP_000991058.1.83657 WP_000991058.1.83677 WP_000991058.1.83923 WP_000991058.1.83994 WP_000991058.1.84 WP_000991058.1.8406 WP_000991058.1.84076 WP_000991058.1.84110 WP_000991058.1.84127 WP_000991058.1.84150 WP_000991058.1.84230 WP_000991058.1.84252 WP_000991058.1.8431 WP_000991058.1.84369 WP_000991058.1.84401 WP_000991058.1.84435 WP_000991058.1.84567 WP_000991058.1.84631 WP_000991058.1.84727 WP_000991058.1.84744 WP_000991058.1.84773 WP_000991058.1.84945 WP_000991058.1.84967 WP_000991058.1.85004 WP_000991058.1.8502 WP_000991058.1.85039 WP_000991058.1.85153 WP_000991058.1.85273 WP_000991058.1.85338 WP_000991058.1.85339 WP_000991058.1.85511 WP_000991058.1.85512 WP_000991058.1.8557 WP_000991058.1.85606 WP_000991058.1.85635 WP_000991058.1.85646 WP_000991058.1.85665 WP_000991058.1.85669 WP_000991058.1.85688 WP_000991058.1.85703 WP_000991058.1.85728 WP_000991058.1.85746 WP_000991058.1.85811 WP_000991058.1.859 WP_000991058.1.85917 WP_000991058.1.8594 WP_000991058.1.85977 WP_000991058.1.860 WP_000991058.1.8605 WP_000991058.1.86084 WP_000991058.1.8610 WP_000991058.1.8614 WP_000991058.1.86156 WP_000991058.1.86323 WP_000991058.1.86342 WP_000991058.1.8640 WP_000991058.1.8642 WP_000991058.1.86426 WP_000991058.1.86489 WP_000991058.1.86530 WP_000991058.1.86663 WP_000991058.1.86770 WP_000991058.1.86794 WP_000991058.1.86800 WP_000991058.1.86811 WP_000991058.1.86815 WP_000991058.1.86945 WP_000991058.1.86989 WP_000991058.1.87023 WP_000991058.1.87034 WP_000991058.1.87041 WP_000991058.1.87136 WP_000991058.1.87155 WP_000991058.1.87258 WP_000991058.1.87293 WP_000991058.1.87420 WP_000991058.1.87528 WP_000991058.1.87560 WP_000991058.1.87600 WP_000991058.1.87609 WP_000991058.1.87612 WP_000991058.1.87615 WP_000991058.1.87653 WP_000991058.1.87659 WP_000991058.1.87698 WP_000991058.1.87706 WP_000991058.1.87739 WP_000991058.1.87741 WP_000991058.1.87742 WP_000991058.1.87852 WP_000991058.1.87949 WP_000991058.1.88025 WP_000991058.1.88026 WP_000991058.1.8805 WP_000991058.1.8806 WP_000991058.1.881 WP_000991058.1.88145 WP_000991058.1.88199 WP_000991058.1.88299 WP_000991058.1.88313 WP_000991058.1.88407 WP_000991058.1.88414 WP_000991058.1.88444 WP_000991058.1.88446 WP_000991058.1.88458 WP_000991058.1.88501 WP_000991058.1.88538 WP_000991058.1.88547 WP_000991058.1.886 WP_000991058.1.88647 WP_000991058.1.88648 WP_000991058.1.88692 WP_000991058.1.88707 WP_000991058.1.88727 WP_000991058.1.88772 WP_000991058.1.88850 WP_000991058.1.88894 WP_000991058.1.89182 WP_000991058.1.89298 WP_000991058.1.89308 WP_000991058.1.89314 WP_000991058.1.89328 WP_000991058.1.89332 WP_000991058.1.89343 WP_000991058.1.89395 WP_000991058.1.8940 WP_000991058.1.89449 WP_000991058.1.8947 WP_000991058.1.89503 WP_000991058.1.89591 WP_000991058.1.89612 WP_000991058.1.89668 WP_000991058.1.89706 WP_000991058.1.89713 WP_000991058.1.89733 WP_000991058.1.89796 WP_000991058.1.89804 WP_000991058.1.89845 WP_000991058.1.89888 WP_000991058.1.89911 WP_000991058.1.8995 WP_000991058.1.89952 WP_000991058.1.90007 WP_000991058.1.9011 WP_000991058.1.90196 WP_000991058.1.90240 WP_000991058.1.90274 WP_000991058.1.90280 WP_000991058.1.90330 WP_000991058.1.90338 WP_000991058.1.90365 WP_000991058.1.90428 WP_000991058.1.90489 WP_000991058.1.90513 WP_000991058.1.90582 WP_000991058.1.90713 WP_000991058.1.90794 WP_000991058.1.90796 WP_000991058.1.90811 WP_000991058.1.9091 WP_000991058.1.91067 WP_000991058.1.91164 WP_000991058.1.91205 WP_000991058.1.91239 WP_000991058.1.91291 WP_000991058.1.91313 WP_000991058.1.9135 WP_000991058.1.91506 WP_000991058.1.91557 WP_000991058.1.91597 WP_000991058.1.91715 WP_000991058.1.9187 WP_000991058.1.91870 WP_000991058.1.92018 WP_000991058.1.92087 WP_000991058.1.92098 WP_000991058.1.92156 WP_000991058.1.92172 WP_000991058.1.92240 WP_000991058.1.92243 WP_000991058.1.92327 WP_000991058.1.92470 WP_000991058.1.92477 WP_000991058.1.92545 WP_000991058.1.92570 WP_000991058.1.92588 WP_000991058.1.926 WP_000991058.1.92633 WP_000991058.1.92649 WP_000991058.1.92676 WP_000991058.1.92705 WP_000991058.1.9271 WP_000991058.1.92734 WP_000991058.1.92810 WP_000991058.1.92823 WP_000991058.1.92987 WP_000991058.1.93007 WP_000991058.1.93022 WP_000991058.1.93103 WP_000991058.1.93105 WP_000991058.1.93111 WP_000991058.1.93121 WP_000991058.1.93168 WP_000991058.1.93184 WP_000991058.1.93221 WP_000991058.1.93223 WP_000991058.1.93239 WP_000991058.1.93302 WP_000991058.1.9336 WP_000991058.1.93387 WP_000991058.1.93469 WP_000991058.1.93512 WP_000991058.1.93635 WP_000991058.1.93657 WP_000991058.1.9374 WP_000991058.1.9375 WP_000991058.1.93754 WP_000991058.1.93780 WP_000991058.1.93828 WP_000991058.1.93842 WP_000991058.1.93843 WP_000991058.1.93875 WP_000991058.1.93909 WP_000991058.1.93919 WP_000991058.1.93938 WP_000991058.1.93984 WP_000991058.1.9399 WP_000991058.1.94017 WP_000991058.1.94079 WP_000991058.1.94097 WP_000991058.1.94107 WP_000991058.1.94142 WP_000991058.1.94215 WP_000991058.1.94303 WP_000991058.1.94365 WP_000991058.1.94390 WP_000991058.1.94415 WP_000991058.1.94492 WP_000991058.1.94510 WP_000991058.1.94527 WP_000991058.1.94573 WP_000991058.1.94579 WP_000991058.1.94586 WP_000991058.1.94593 WP_000991058.1.94650 WP_000991058.1.94659 WP_000991058.1.94662 WP_000991058.1.94700 WP_000991058.1.94745 WP_000991058.1.94782 WP_000991058.1.94815 WP_000991058.1.94820 WP_000991058.1.94850 WP_000991058.1.94851 WP_000991058.1.94864 WP_000991058.1.94952 WP_000991058.1.95006 WP_000991058.1.95055 WP_000991058.1.95076 WP_000991058.1.95099 WP_000991058.1.95165 WP_000991058.1.95239 WP_000991058.1.95246 WP_000991058.1.9525 WP_000991058.1.95255 WP_000991058.1.95265 WP_000991058.1.95338 WP_000991058.1.95412 WP_000991058.1.95530 WP_000991058.1.95547 WP_000991058.1.95590 WP_000991058.1.95625 WP_000991058.1.95675 WP_000991058.1.95716 WP_000991058.1.95776 WP_000991058.1.95884 WP_000991058.1.95890 WP_000991058.1.95906 WP_000991058.1.96025 WP_000991058.1.96044 WP_000991058.1.96054 WP_000991058.1.96094 WP_000991058.1.96127 WP_000991058.1.96144 WP_000991058.1.96188 WP_000991058.1.96211 WP_000991058.1.96212 WP_000991058.1.96319 WP_000991058.1.9633 WP_000991058.1.96359 WP_000991058.1.96539 WP_000991058.1.96552 WP_000991058.1.96610 WP_000991058.1.96625 WP_000991058.1.96635 WP_000991058.1.9664 WP_000991058.1.96675 WP_000991058.1.9670 WP_000991058.1.96750 WP_000991058.1.96792 WP_000991058.1.96801 WP_000991058.1.96803 WP_000991058.1.96925 WP_000991058.1.96938 WP_000991058.1.96946 WP_000991058.1.96957 WP_000991058.1.96978 WP_000991058.1.97026 WP_000991058.1.97028 WP_000991058.1.97154 WP_000991058.1.97184 WP_000991058.1.97287 WP_000991058.1.97291 WP_000991058.1.97422 WP_000991058.1.97441 WP_000991058.1.97497 WP_000991058.1.97505 WP_000991058.1.97599 WP_000991058.1.97606 WP_000991058.1.97615 WP_000991058.1.97646 WP_000991058.1.97690 WP_000991058.1.97819 WP_000991058.1.97840 WP_000991058.1.97938 WP_000991058.1.97986 WP_000991058.1.98036 WP_000991058.1.98080 WP_000991058.1.98086 WP_000991058.1.98158 WP_000991058.1.98263 WP_000991058.1.98418 WP_000991058.1.98448 WP_000991058.1.98457 WP_000991058.1.9850 WP_000991058.1.98502 WP_000991058.1.98607 WP_000991058.1.98731 WP_000991058.1.98762 WP_000991058.1.9877 WP_000991058.1.98801 WP_000991058.1.98818 WP_000991058.1.99163 WP_000991058.1.99335 WP_000991058.1.99350 WP_000991058.1.99360 WP_000991058.1.99363 WP_000991058.1.99369 WP_000991058.1.99388 WP_000991058.1.99397 WP_000991058.1.99463 WP_000991058.1.99483 WP_000991058.1.99546 WP_000991058.1.99579 WP_000991058.1.99595 WP_000991058.1.99671 WP_000991058.1.99676 WP_000991058.1.99764 WP_000991058.1.99829 WP_000991058.1.99837 WP_000991058.1.99841 WP_000991058.1.9992 WP_000991058.1.99996 gi|16761762|ref|NP_457379.1| 209261.t2892 220341.STY3124 gi|29143246|ref|NP_806588.1| AE014613|CDS_2977389-2978594 AL513382|CDS_2991494-2992699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]