SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16762205|ref|NP_457822.1| from Salmonella enterica subsp. enterica serovar Typhi str. CT18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16762205|ref|NP_457822.1|
Domain Number 1 Region: 2-375
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.71e-102
Family GABA-aminotransferase-like 0.0000453
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16762205|ref|NP_457822.1|
Sequence length 376
Comment lipopolysaccharide biosynthesis protein [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
Sequence
MIPFNAPPVVGTELEYMQSAMSSGKLCGDGGFTRRCQQWLEQHFGSAKVLLTPSCTASLE
MAALLLDIQPGDEVIMPSFTFVSTANAFVLRGAKIVFVDIRPDTMNIDETLIEAAITDKT
RAIVPVHYAGVACEMDVIMALADKYNLFVVEDAAQGVMSTYKGRALGTIGHIGCFSFHET
KNYTAGGEGGATLINDRTLIERAEIIREKGTNRSQFFRGQVDKYTWRDIGSSYLMSDLQA
AYLWAQLEAADRINQQRLSLWQTYYDALTPLARAGRIELPSIPENCGHNAHMFYIKLRDI
ADRSALINFLKEAEIMAVFHYIPLHDCPAGDKFGEFIGDDVYTTKESERLLRLPLFYNLA
PVDQRTVITTLLNYFS
Download sequence
Identical sequences A0A0H3BRE5 A0A0L3JI75 A0A0N1R053 A0A0R9PFE1 A0A100PRD8 A0A1C3A086 A0A1J4QMW1 A0A1R2T9I7 A0A1X2RJ08 A0A1X2UL99 A0A1X2Y0V1 A0A1Z3Q9D8 A0A221Z6M5 A0A267SEZ6 A0A271CKG7 A0A271CRA9 A0A2C6G5L3 A0A2D1XY30 A0A2D3U2C7 A0A2G1NQ66 A0A2I6MEN4 A0A2I6N629 A0A2I6NJA6 A0A2I6NXB3 A0A2I6P9Q0 A0A2K2Z6F9 B5EZ50 C0Q3A4 G4C8P6 M7RM64 Q8Z393 S4IQS0 V7UFS5
gi|197248155|ref|YP_002148854.1| NP_457822.1.84458 WP_000612080.1.100002 WP_000612080.1.100007 WP_000612080.1.100008 WP_000612080.1.100017 WP_000612080.1.100031 WP_000612080.1.100036 WP_000612080.1.100077 WP_000612080.1.100079 WP_000612080.1.100129 WP_000612080.1.10013 WP_000612080.1.100149 WP_000612080.1.100165 WP_000612080.1.100191 WP_000612080.1.100196 WP_000612080.1.1002 WP_000612080.1.100266 WP_000612080.1.100284 WP_000612080.1.100313 WP_000612080.1.100314 WP_000612080.1.100321 WP_000612080.1.100354 WP_000612080.1.100392 WP_000612080.1.100412 WP_000612080.1.100413 WP_000612080.1.100421 WP_000612080.1.100432 WP_000612080.1.100446 WP_000612080.1.100450 WP_000612080.1.100457 WP_000612080.1.100472 WP_000612080.1.100502 WP_000612080.1.100519 WP_000612080.1.100521 WP_000612080.1.100557 WP_000612080.1.100589 WP_000612080.1.100592 WP_000612080.1.100605 WP_000612080.1.100610 WP_000612080.1.100642 WP_000612080.1.10065 WP_000612080.1.100650 WP_000612080.1.100707 WP_000612080.1.100711 WP_000612080.1.100714 WP_000612080.1.100721 WP_000612080.1.100732 WP_000612080.1.100733 WP_000612080.1.100739 WP_000612080.1.100764 WP_000612080.1.100773 WP_000612080.1.100776 WP_000612080.1.100790 WP_000612080.1.100799 WP_000612080.1.10081 WP_000612080.1.100857 WP_000612080.1.100865 WP_000612080.1.100870 WP_000612080.1.100895 WP_000612080.1.100932 WP_000612080.1.100941 WP_000612080.1.100948 WP_000612080.1.100953 WP_000612080.1.101011 WP_000612080.1.101042 WP_000612080.1.10108 WP_000612080.1.101091 WP_000612080.1.101094 WP_000612080.1.101112 WP_000612080.1.101123 WP_000612080.1.101126 WP_000612080.1.101147 WP_000612080.1.101199 WP_000612080.1.101223 WP_000612080.1.101226 WP_000612080.1.10124 WP_000612080.1.101271 WP_000612080.1.101312 WP_000612080.1.101322 WP_000612080.1.101374 WP_000612080.1.101425 WP_000612080.1.101454 WP_000612080.1.101473 WP_000612080.1.101520 WP_000612080.1.101541 WP_000612080.1.101609 WP_000612080.1.101616 WP_000612080.1.101634 WP_000612080.1.101636 WP_000612080.1.101639 WP_000612080.1.10164 WP_000612080.1.101674 WP_000612080.1.101724 WP_000612080.1.101740 WP_000612080.1.101741 WP_000612080.1.101744 WP_000612080.1.101776 WP_000612080.1.101832 WP_000612080.1.101841 WP_000612080.1.101868 WP_000612080.1.101890 WP_000612080.1.10191 WP_000612080.1.101917 WP_000612080.1.101927 WP_000612080.1.101941 WP_000612080.1.101975 WP_000612080.1.102009 WP_000612080.1.102050 WP_000612080.1.102087 WP_000612080.1.102103 WP_000612080.1.102111 WP_000612080.1.10237 WP_000612080.1.10293 WP_000612080.1.10300 WP_000612080.1.10310 WP_000612080.1.10338 WP_000612080.1.1038 WP_000612080.1.10394 WP_000612080.1.104 WP_000612080.1.10401 WP_000612080.1.10428 WP_000612080.1.10459 WP_000612080.1.10463 WP_000612080.1.10475 WP_000612080.1.10498 WP_000612080.1.10507 WP_000612080.1.10511 WP_000612080.1.10514 WP_000612080.1.10521 WP_000612080.1.10530 WP_000612080.1.10532 WP_000612080.1.10547 WP_000612080.1.10562 WP_000612080.1.10595 WP_000612080.1.106 WP_000612080.1.10631 WP_000612080.1.10642 WP_000612080.1.10654 WP_000612080.1.10675 WP_000612080.1.10677 WP_000612080.1.10711 WP_000612080.1.10755 WP_000612080.1.10797 WP_000612080.1.10857 WP_000612080.1.10868 WP_000612080.1.10873 WP_000612080.1.10898 WP_000612080.1.10926 WP_000612080.1.10936 WP_000612080.1.11012 WP_000612080.1.11055 WP_000612080.1.11119 WP_000612080.1.11126 WP_000612080.1.11142 WP_000612080.1.11213 WP_000612080.1.11216 WP_000612080.1.11239 WP_000612080.1.11253 WP_000612080.1.11254 WP_000612080.1.11314 WP_000612080.1.1135 WP_000612080.1.11362 WP_000612080.1.11369 WP_000612080.1.11385 WP_000612080.1.11405 WP_000612080.1.1142 WP_000612080.1.11426 WP_000612080.1.11429 WP_000612080.1.11479 WP_000612080.1.1150 WP_000612080.1.11511 WP_000612080.1.11526 WP_000612080.1.11528 WP_000612080.1.11544 WP_000612080.1.11557 WP_000612080.1.1156 WP_000612080.1.11567 WP_000612080.1.11603 WP_000612080.1.11621 WP_000612080.1.11638 WP_000612080.1.1169 WP_000612080.1.1174 WP_000612080.1.11824 WP_000612080.1.11841 WP_000612080.1.11865 WP_000612080.1.11875 WP_000612080.1.11883 WP_000612080.1.11900 WP_000612080.1.11908 WP_000612080.1.11914 WP_000612080.1.11938 WP_000612080.1.11964 WP_000612080.1.11978 WP_000612080.1.12007 WP_000612080.1.12027 WP_000612080.1.12040 WP_000612080.1.12047 WP_000612080.1.12059 WP_000612080.1.12061 WP_000612080.1.12063 WP_000612080.1.1207 WP_000612080.1.12106 WP_000612080.1.12141 WP_000612080.1.12144 WP_000612080.1.1215 WP_000612080.1.12160 WP_000612080.1.12168 WP_000612080.1.12172 WP_000612080.1.12192 WP_000612080.1.1224 WP_000612080.1.12282 WP_000612080.1.12340 WP_000612080.1.12364 WP_000612080.1.12374 WP_000612080.1.1239 WP_000612080.1.12396 WP_000612080.1.12397 WP_000612080.1.12398 WP_000612080.1.12441 WP_000612080.1.12456 WP_000612080.1.1246 WP_000612080.1.12485 WP_000612080.1.1250 WP_000612080.1.12568 WP_000612080.1.12569 WP_000612080.1.12581 WP_000612080.1.12585 WP_000612080.1.12620 WP_000612080.1.12648 WP_000612080.1.12650 WP_000612080.1.12683 WP_000612080.1.12696 WP_000612080.1.12701 WP_000612080.1.12726 WP_000612080.1.12727 WP_000612080.1.12741 WP_000612080.1.12834 WP_000612080.1.12877 WP_000612080.1.1299 WP_000612080.1.1300 WP_000612080.1.13076 WP_000612080.1.13102 WP_000612080.1.13108 WP_000612080.1.13161 WP_000612080.1.1321 WP_000612080.1.13247 WP_000612080.1.1326 WP_000612080.1.13268 WP_000612080.1.13274 WP_000612080.1.13291 WP_000612080.1.133 WP_000612080.1.13311 WP_000612080.1.13314 WP_000612080.1.13338 WP_000612080.1.13342 WP_000612080.1.13352 WP_000612080.1.13367 WP_000612080.1.13391 WP_000612080.1.13406 WP_000612080.1.13440 WP_000612080.1.13443 WP_000612080.1.1346 WP_000612080.1.13476 WP_000612080.1.13528 WP_000612080.1.13573 WP_000612080.1.13599 WP_000612080.1.13625 WP_000612080.1.13677 WP_000612080.1.13686 WP_000612080.1.13691 WP_000612080.1.1372 WP_000612080.1.13732 WP_000612080.1.13750 WP_000612080.1.13799 WP_000612080.1.13819 WP_000612080.1.1382 WP_000612080.1.13827 WP_000612080.1.13829 WP_000612080.1.1397 WP_000612080.1.13972 WP_000612080.1.140 WP_000612080.1.1401 WP_000612080.1.14011 WP_000612080.1.14041 WP_000612080.1.14050 WP_000612080.1.14056 WP_000612080.1.1408 WP_000612080.1.14089 WP_000612080.1.14099 WP_000612080.1.1412 WP_000612080.1.14120 WP_000612080.1.14123 WP_000612080.1.14150 WP_000612080.1.14191 WP_000612080.1.14197 WP_000612080.1.14280 WP_000612080.1.14296 WP_000612080.1.14333 WP_000612080.1.14399 WP_000612080.1.14444 WP_000612080.1.14446 WP_000612080.1.14467 WP_000612080.1.14474 WP_000612080.1.14500 WP_000612080.1.14505 WP_000612080.1.14519 WP_000612080.1.14526 WP_000612080.1.14528 WP_000612080.1.14550 WP_000612080.1.14575 WP_000612080.1.146 WP_000612080.1.14688 WP_000612080.1.14701 WP_000612080.1.14703 WP_000612080.1.14706 WP_000612080.1.14708 WP_000612080.1.14719 WP_000612080.1.1473 WP_000612080.1.14737 WP_000612080.1.14765 WP_000612080.1.14789 WP_000612080.1.14793 WP_000612080.1.14808 WP_000612080.1.14810 WP_000612080.1.14819 WP_000612080.1.14876 WP_000612080.1.14877 WP_000612080.1.14894 WP_000612080.1.14913 WP_000612080.1.14917 WP_000612080.1.14927 WP_000612080.1.14930 WP_000612080.1.14947 WP_000612080.1.14948 WP_000612080.1.15046 WP_000612080.1.15054 WP_000612080.1.15059 WP_000612080.1.15067 WP_000612080.1.15102 WP_000612080.1.15184 WP_000612080.1.15214 WP_000612080.1.15244 WP_000612080.1.15265 WP_000612080.1.15276 WP_000612080.1.15318 WP_000612080.1.15362 WP_000612080.1.15415 WP_000612080.1.15423 WP_000612080.1.15433 WP_000612080.1.15439 WP_000612080.1.15479 WP_000612080.1.15483 WP_000612080.1.15487 WP_000612080.1.1551 WP_000612080.1.15535 WP_000612080.1.15581 WP_000612080.1.15585 WP_000612080.1.15597 WP_000612080.1.15616 WP_000612080.1.15625 WP_000612080.1.15627 WP_000612080.1.15637 WP_000612080.1.15644 WP_000612080.1.1568 WP_000612080.1.15708 WP_000612080.1.15710 WP_000612080.1.15717 WP_000612080.1.15775 WP_000612080.1.15777 WP_000612080.1.15795 WP_000612080.1.158 WP_000612080.1.15835 WP_000612080.1.15881 WP_000612080.1.15905 WP_000612080.1.15912 WP_000612080.1.15922 WP_000612080.1.15970 WP_000612080.1.15978 WP_000612080.1.16006 WP_000612080.1.1601 WP_000612080.1.16032 WP_000612080.1.16046 WP_000612080.1.16051 WP_000612080.1.16052 WP_000612080.1.16058 WP_000612080.1.1611 WP_000612080.1.16150 WP_000612080.1.16155 WP_000612080.1.16158 WP_000612080.1.16166 WP_000612080.1.16172 WP_000612080.1.16244 WP_000612080.1.1626 WP_000612080.1.16264 WP_000612080.1.16273 WP_000612080.1.16331 WP_000612080.1.16344 WP_000612080.1.16363 WP_000612080.1.16365 WP_000612080.1.16366 WP_000612080.1.16394 WP_000612080.1.16452 WP_000612080.1.16453 WP_000612080.1.16461 WP_000612080.1.16462 WP_000612080.1.16465 WP_000612080.1.16474 WP_000612080.1.16508 WP_000612080.1.16522 WP_000612080.1.16551 WP_000612080.1.16565 WP_000612080.1.16588 WP_000612080.1.16656 WP_000612080.1.16658 WP_000612080.1.16666 WP_000612080.1.16673 WP_000612080.1.16729 WP_000612080.1.16736 WP_000612080.1.1674 WP_000612080.1.16767 WP_000612080.1.16781 WP_000612080.1.16804 WP_000612080.1.16826 WP_000612080.1.16855 WP_000612080.1.16879 WP_000612080.1.1689 WP_000612080.1.16893 WP_000612080.1.16905 WP_000612080.1.16910 WP_000612080.1.16941 WP_000612080.1.16944 WP_000612080.1.16948 WP_000612080.1.16949 WP_000612080.1.16972 WP_000612080.1.17031 WP_000612080.1.17049 WP_000612080.1.17058 WP_000612080.1.17060 WP_000612080.1.17078 WP_000612080.1.17096 WP_000612080.1.17098 WP_000612080.1.17105 WP_000612080.1.17188 WP_000612080.1.17202 WP_000612080.1.17219 WP_000612080.1.1722 WP_000612080.1.17270 WP_000612080.1.17285 WP_000612080.1.17302 WP_000612080.1.17308 WP_000612080.1.1733 WP_000612080.1.17368 WP_000612080.1.1737 WP_000612080.1.17390 WP_000612080.1.17405 WP_000612080.1.17406 WP_000612080.1.17447 WP_000612080.1.17482 WP_000612080.1.17504 WP_000612080.1.17513 WP_000612080.1.17525 WP_000612080.1.17543 WP_000612080.1.17563 WP_000612080.1.1757 WP_000612080.1.17578 WP_000612080.1.17583 WP_000612080.1.17622 WP_000612080.1.17659 WP_000612080.1.17667 WP_000612080.1.17686 WP_000612080.1.17693 WP_000612080.1.17732 WP_000612080.1.17741 WP_000612080.1.17755 WP_000612080.1.17840 WP_000612080.1.17865 WP_000612080.1.17886 WP_000612080.1.17914 WP_000612080.1.17919 WP_000612080.1.17936 WP_000612080.1.17949 WP_000612080.1.17956 WP_000612080.1.17991 WP_000612080.1.18005 WP_000612080.1.1801 WP_000612080.1.18021 WP_000612080.1.18056 WP_000612080.1.18061 WP_000612080.1.1807 WP_000612080.1.18089 WP_000612080.1.18092 WP_000612080.1.18099 WP_000612080.1.18109 WP_000612080.1.18124 WP_000612080.1.1814 WP_000612080.1.18144 WP_000612080.1.18149 WP_000612080.1.18173 WP_000612080.1.18177 WP_000612080.1.18249 WP_000612080.1.1825 WP_000612080.1.18270 WP_000612080.1.18277 WP_000612080.1.18280 WP_000612080.1.18281 WP_000612080.1.18328 WP_000612080.1.18358 WP_000612080.1.18365 WP_000612080.1.18370 WP_000612080.1.18384 WP_000612080.1.18406 WP_000612080.1.18445 WP_000612080.1.18474 WP_000612080.1.18485 WP_000612080.1.18489 WP_000612080.1.18513 WP_000612080.1.18610 WP_000612080.1.18641 WP_000612080.1.18678 WP_000612080.1.18686 WP_000612080.1.18722 WP_000612080.1.18737 WP_000612080.1.18766 WP_000612080.1.1880 WP_000612080.1.18847 WP_000612080.1.1885 WP_000612080.1.18860 WP_000612080.1.18886 WP_000612080.1.18895 WP_000612080.1.18919 WP_000612080.1.18922 WP_000612080.1.1895 WP_000612080.1.18959 WP_000612080.1.1897 WP_000612080.1.18972 WP_000612080.1.19001 WP_000612080.1.19006 WP_000612080.1.19038 WP_000612080.1.19044 WP_000612080.1.19084 WP_000612080.1.19093 WP_000612080.1.19174 WP_000612080.1.19187 WP_000612080.1.19228 WP_000612080.1.19240 WP_000612080.1.19288 WP_000612080.1.19300 WP_000612080.1.19340 WP_000612080.1.19373 WP_000612080.1.1939 WP_000612080.1.19405 WP_000612080.1.19422 WP_000612080.1.19433 WP_000612080.1.19454 WP_000612080.1.19456 WP_000612080.1.19469 WP_000612080.1.19496 WP_000612080.1.19535 WP_000612080.1.19538 WP_000612080.1.1954 WP_000612080.1.1955 WP_000612080.1.19589 WP_000612080.1.19656 WP_000612080.1.19660 WP_000612080.1.19663 WP_000612080.1.1968 WP_000612080.1.19683 WP_000612080.1.19686 WP_000612080.1.19731 WP_000612080.1.19740 WP_000612080.1.19794 WP_000612080.1.19823 WP_000612080.1.19834 WP_000612080.1.19863 WP_000612080.1.19884 WP_000612080.1.1990 WP_000612080.1.1992 WP_000612080.1.19987 WP_000612080.1.19999 WP_000612080.1.20023 WP_000612080.1.20034 WP_000612080.1.20081 WP_000612080.1.20086 WP_000612080.1.20091 WP_000612080.1.20254 WP_000612080.1.20255 WP_000612080.1.2026 WP_000612080.1.20261 WP_000612080.1.20296 WP_000612080.1.20339 WP_000612080.1.2036 WP_000612080.1.20364 WP_000612080.1.20376 WP_000612080.1.20391 WP_000612080.1.2041 WP_000612080.1.20415 WP_000612080.1.20419 WP_000612080.1.20425 WP_000612080.1.20437 WP_000612080.1.20465 WP_000612080.1.20488 WP_000612080.1.20492 WP_000612080.1.20503 WP_000612080.1.2053 WP_000612080.1.20573 WP_000612080.1.20635 WP_000612080.1.20695 WP_000612080.1.20700 WP_000612080.1.20718 WP_000612080.1.2073 WP_000612080.1.20740 WP_000612080.1.20760 WP_000612080.1.20767 WP_000612080.1.20787 WP_000612080.1.20795 WP_000612080.1.20810 WP_000612080.1.20828 WP_000612080.1.20862 WP_000612080.1.2087 WP_000612080.1.20883 WP_000612080.1.20894 WP_000612080.1.20900 WP_000612080.1.2091 WP_000612080.1.20947 WP_000612080.1.20953 WP_000612080.1.2101 WP_000612080.1.21010 WP_000612080.1.2106 WP_000612080.1.21062 WP_000612080.1.2107 WP_000612080.1.21075 WP_000612080.1.21079 WP_000612080.1.21086 WP_000612080.1.21103 WP_000612080.1.21144 WP_000612080.1.2116 WP_000612080.1.21162 WP_000612080.1.21165 WP_000612080.1.21184 WP_000612080.1.21185 WP_000612080.1.21194 WP_000612080.1.21202 WP_000612080.1.21241 WP_000612080.1.21260 WP_000612080.1.21332 WP_000612080.1.21362 WP_000612080.1.21366 WP_000612080.1.21404 WP_000612080.1.21423 WP_000612080.1.21453 WP_000612080.1.2146 WP_000612080.1.21473 WP_000612080.1.21492 WP_000612080.1.21616 WP_000612080.1.2166 WP_000612080.1.21674 WP_000612080.1.21681 WP_000612080.1.21715 WP_000612080.1.21728 WP_000612080.1.21730 WP_000612080.1.21750 WP_000612080.1.21792 WP_000612080.1.21825 WP_000612080.1.21877 WP_000612080.1.21886 WP_000612080.1.21909 WP_000612080.1.21946 WP_000612080.1.21950 WP_000612080.1.21966 WP_000612080.1.22051 WP_000612080.1.22064 WP_000612080.1.22069 WP_000612080.1.22096 WP_000612080.1.22118 WP_000612080.1.22126 WP_000612080.1.22136 WP_000612080.1.22158 WP_000612080.1.2216 WP_000612080.1.22162 WP_000612080.1.22208 WP_000612080.1.2224 WP_000612080.1.22240 WP_000612080.1.2227 WP_000612080.1.22296 WP_000612080.1.22315 WP_000612080.1.22337 WP_000612080.1.22346 WP_000612080.1.22373 WP_000612080.1.22449 WP_000612080.1.22453 WP_000612080.1.22454 WP_000612080.1.22476 WP_000612080.1.22514 WP_000612080.1.22575 WP_000612080.1.22582 WP_000612080.1.22590 WP_000612080.1.22595 WP_000612080.1.22604 WP_000612080.1.22605 WP_000612080.1.22614 WP_000612080.1.22623 WP_000612080.1.22652 WP_000612080.1.22683 WP_000612080.1.22760 WP_000612080.1.2283 WP_000612080.1.2284 WP_000612080.1.22845 WP_000612080.1.22857 WP_000612080.1.22880 WP_000612080.1.22895 WP_000612080.1.22902 WP_000612080.1.22926 WP_000612080.1.22943 WP_000612080.1.22947 WP_000612080.1.22966 WP_000612080.1.22967 WP_000612080.1.23010 WP_000612080.1.23040 WP_000612080.1.23053 WP_000612080.1.23058 WP_000612080.1.23148 WP_000612080.1.23169 WP_000612080.1.23172 WP_000612080.1.23218 WP_000612080.1.2324 WP_000612080.1.23258 WP_000612080.1.23274 WP_000612080.1.2331 WP_000612080.1.2332 WP_000612080.1.23329 WP_000612080.1.23340 WP_000612080.1.2336 WP_000612080.1.23365 WP_000612080.1.23409 WP_000612080.1.23412 WP_000612080.1.23426 WP_000612080.1.23442 WP_000612080.1.23444 WP_000612080.1.23466 WP_000612080.1.23485 WP_000612080.1.23492 WP_000612080.1.235 WP_000612080.1.23513 WP_000612080.1.23515 WP_000612080.1.23529 WP_000612080.1.23548 WP_000612080.1.23571 WP_000612080.1.2358 WP_000612080.1.23587 WP_000612080.1.23604 WP_000612080.1.23621 WP_000612080.1.23629 WP_000612080.1.23631 WP_000612080.1.23646 WP_000612080.1.23675 WP_000612080.1.23679 WP_000612080.1.23707 WP_000612080.1.23728 WP_000612080.1.23736 WP_000612080.1.23746 WP_000612080.1.2375 WP_000612080.1.2376 WP_000612080.1.23783 WP_000612080.1.23786 WP_000612080.1.23787 WP_000612080.1.23801 WP_000612080.1.23819 WP_000612080.1.24028 WP_000612080.1.24061 WP_000612080.1.24083 WP_000612080.1.24117 WP_000612080.1.24125 WP_000612080.1.24138 WP_000612080.1.24145 WP_000612080.1.2415 WP_000612080.1.24153 WP_000612080.1.24158 WP_000612080.1.24214 WP_000612080.1.24250 WP_000612080.1.24291 WP_000612080.1.24297 WP_000612080.1.24303 WP_000612080.1.24322 WP_000612080.1.24325 WP_000612080.1.24355 WP_000612080.1.24361 WP_000612080.1.24375 WP_000612080.1.24392 WP_000612080.1.24400 WP_000612080.1.24408 WP_000612080.1.24409 WP_000612080.1.24412 WP_000612080.1.24420 WP_000612080.1.24450 WP_000612080.1.24476 WP_000612080.1.24494 WP_000612080.1.24521 WP_000612080.1.24619 WP_000612080.1.24643 WP_000612080.1.24673 WP_000612080.1.24688 WP_000612080.1.24689 WP_000612080.1.24696 WP_000612080.1.24716 WP_000612080.1.24723 WP_000612080.1.24803 WP_000612080.1.2481 WP_000612080.1.24832 WP_000612080.1.24837 WP_000612080.1.24873 WP_000612080.1.24901 WP_000612080.1.24944 WP_000612080.1.24964 WP_000612080.1.24995 WP_000612080.1.25017 WP_000612080.1.25032 WP_000612080.1.25041 WP_000612080.1.25053 WP_000612080.1.25130 WP_000612080.1.25140 WP_000612080.1.25159 WP_000612080.1.25175 WP_000612080.1.25185 WP_000612080.1.25196 WP_000612080.1.25205 WP_000612080.1.25210 WP_000612080.1.25217 WP_000612080.1.25219 WP_000612080.1.25229 WP_000612080.1.25297 WP_000612080.1.25304 WP_000612080.1.25354 WP_000612080.1.25374 WP_000612080.1.25397 WP_000612080.1.25421 WP_000612080.1.25426 WP_000612080.1.25475 WP_000612080.1.25490 WP_000612080.1.25498 WP_000612080.1.25508 WP_000612080.1.25512 WP_000612080.1.25514 WP_000612080.1.2554 WP_000612080.1.25546 WP_000612080.1.25603 WP_000612080.1.25618 WP_000612080.1.2562 WP_000612080.1.25666 WP_000612080.1.2568 WP_000612080.1.25700 WP_000612080.1.25703 WP_000612080.1.25708 WP_000612080.1.25709 WP_000612080.1.25780 WP_000612080.1.25807 WP_000612080.1.25809 WP_000612080.1.25821 WP_000612080.1.25825 WP_000612080.1.25833 WP_000612080.1.25835 WP_000612080.1.25882 WP_000612080.1.25911 WP_000612080.1.25928 WP_000612080.1.25932 WP_000612080.1.25944 WP_000612080.1.25951 WP_000612080.1.25962 WP_000612080.1.25963 WP_000612080.1.26001 WP_000612080.1.26027 WP_000612080.1.26034 WP_000612080.1.26075 WP_000612080.1.26083 WP_000612080.1.26093 WP_000612080.1.26107 WP_000612080.1.26129 WP_000612080.1.2615 WP_000612080.1.26194 WP_000612080.1.26199 WP_000612080.1.26213 WP_000612080.1.26217 WP_000612080.1.26224 WP_000612080.1.26230 WP_000612080.1.26232 WP_000612080.1.26269 WP_000612080.1.26272 WP_000612080.1.26286 WP_000612080.1.26288 WP_000612080.1.26363 WP_000612080.1.26384 WP_000612080.1.26394 WP_000612080.1.26426 WP_000612080.1.26441 WP_000612080.1.26491 WP_000612080.1.26512 WP_000612080.1.26532 WP_000612080.1.2654 WP_000612080.1.26554 WP_000612080.1.26587 WP_000612080.1.26636 WP_000612080.1.26646 WP_000612080.1.2667 WP_000612080.1.26687 WP_000612080.1.26689 WP_000612080.1.26709 WP_000612080.1.2672 WP_000612080.1.26787 WP_000612080.1.2679 WP_000612080.1.26794 WP_000612080.1.26833 WP_000612080.1.26882 WP_000612080.1.26883 WP_000612080.1.26908 WP_000612080.1.2692 WP_000612080.1.26928 WP_000612080.1.26936 WP_000612080.1.26980 WP_000612080.1.270 WP_000612080.1.27008 WP_000612080.1.27027 WP_000612080.1.27055 WP_000612080.1.27070 WP_000612080.1.27072 WP_000612080.1.27077 WP_000612080.1.27086 WP_000612080.1.27087 WP_000612080.1.27111 WP_000612080.1.27115 WP_000612080.1.2713 WP_000612080.1.27169 WP_000612080.1.2717 WP_000612080.1.272 WP_000612080.1.27228 WP_000612080.1.2723 WP_000612080.1.27255 WP_000612080.1.27272 WP_000612080.1.27279 WP_000612080.1.27282 WP_000612080.1.27285 WP_000612080.1.27309 WP_000612080.1.27314 WP_000612080.1.27329 WP_000612080.1.27342 WP_000612080.1.27361 WP_000612080.1.27383 WP_000612080.1.27419 WP_000612080.1.27452 WP_000612080.1.27513 WP_000612080.1.27522 WP_000612080.1.27523 WP_000612080.1.27547 WP_000612080.1.27565 WP_000612080.1.27595 WP_000612080.1.27598 WP_000612080.1.27616 WP_000612080.1.27632 WP_000612080.1.27638 WP_000612080.1.27655 WP_000612080.1.27658 WP_000612080.1.27706 WP_000612080.1.27755 WP_000612080.1.27775 WP_000612080.1.27785 WP_000612080.1.27800 WP_000612080.1.27815 WP_000612080.1.27833 WP_000612080.1.27883 WP_000612080.1.27900 WP_000612080.1.27928 WP_000612080.1.27945 WP_000612080.1.27995 WP_000612080.1.27997 WP_000612080.1.28002 WP_000612080.1.28004 WP_000612080.1.28037 WP_000612080.1.28056 WP_000612080.1.2806 WP_000612080.1.2809 WP_000612080.1.28116 WP_000612080.1.28139 WP_000612080.1.28155 WP_000612080.1.28174 WP_000612080.1.28198 WP_000612080.1.28200 WP_000612080.1.2822 WP_000612080.1.28229 WP_000612080.1.28232 WP_000612080.1.28233 WP_000612080.1.2825 WP_000612080.1.28267 WP_000612080.1.2829 WP_000612080.1.28301 WP_000612080.1.28303 WP_000612080.1.28384 WP_000612080.1.28386 WP_000612080.1.28395 WP_000612080.1.284 WP_000612080.1.2845 WP_000612080.1.28462 WP_000612080.1.28479 WP_000612080.1.28514 WP_000612080.1.2853 WP_000612080.1.28570 WP_000612080.1.28612 WP_000612080.1.28620 WP_000612080.1.28627 WP_000612080.1.28692 WP_000612080.1.287 WP_000612080.1.2873 WP_000612080.1.28773 WP_000612080.1.28776 WP_000612080.1.28811 WP_000612080.1.28917 WP_000612080.1.28921 WP_000612080.1.28948 WP_000612080.1.28962 WP_000612080.1.28963 WP_000612080.1.28977 WP_000612080.1.29023 WP_000612080.1.29042 WP_000612080.1.2905 WP_000612080.1.2907 WP_000612080.1.29081 WP_000612080.1.29089 WP_000612080.1.29130 WP_000612080.1.29153 WP_000612080.1.29168 WP_000612080.1.29190 WP_000612080.1.29203 WP_000612080.1.29218 WP_000612080.1.29237 WP_000612080.1.2924 WP_000612080.1.29248 WP_000612080.1.29265 WP_000612080.1.29274 WP_000612080.1.29288 WP_000612080.1.2932 WP_000612080.1.29349 WP_000612080.1.29379 WP_000612080.1.29389 WP_000612080.1.29422 WP_000612080.1.29436 WP_000612080.1.29439 WP_000612080.1.2946 WP_000612080.1.29462 WP_000612080.1.29563 WP_000612080.1.29576 WP_000612080.1.29727 WP_000612080.1.29732 WP_000612080.1.29743 WP_000612080.1.29775 WP_000612080.1.29782 WP_000612080.1.29833 WP_000612080.1.2984 WP_000612080.1.29845 WP_000612080.1.29851 WP_000612080.1.29865 WP_000612080.1.29886 WP_000612080.1.29898 WP_000612080.1.29919 WP_000612080.1.29923 WP_000612080.1.29924 WP_000612080.1.2994 WP_000612080.1.29964 WP_000612080.1.29983 WP_000612080.1.30009 WP_000612080.1.30013 WP_000612080.1.3002 WP_000612080.1.30034 WP_000612080.1.30049 WP_000612080.1.3005 WP_000612080.1.30058 WP_000612080.1.30059 WP_000612080.1.30086 WP_000612080.1.30093 WP_000612080.1.30165 WP_000612080.1.3017 WP_000612080.1.30172 WP_000612080.1.30185 WP_000612080.1.30210 WP_000612080.1.30225 WP_000612080.1.30238 WP_000612080.1.30246 WP_000612080.1.30278 WP_000612080.1.30331 WP_000612080.1.30354 WP_000612080.1.30356 WP_000612080.1.30357 WP_000612080.1.30362 WP_000612080.1.30386 WP_000612080.1.30389 WP_000612080.1.3042 WP_000612080.1.30421 WP_000612080.1.30440 WP_000612080.1.30448 WP_000612080.1.30489 WP_000612080.1.30492 WP_000612080.1.30517 WP_000612080.1.30542 WP_000612080.1.30544 WP_000612080.1.30548 WP_000612080.1.30556 WP_000612080.1.30572 WP_000612080.1.30573 WP_000612080.1.30585 WP_000612080.1.30589 WP_000612080.1.30602 WP_000612080.1.30618 WP_000612080.1.30619 WP_000612080.1.30627 WP_000612080.1.3066 WP_000612080.1.30664 WP_000612080.1.3067 WP_000612080.1.3068 WP_000612080.1.30688 WP_000612080.1.30696 WP_000612080.1.30752 WP_000612080.1.3080 WP_000612080.1.30802 WP_000612080.1.30803 WP_000612080.1.30806 WP_000612080.1.30909 WP_000612080.1.30934 WP_000612080.1.3095 WP_000612080.1.30951 WP_000612080.1.30967 WP_000612080.1.30968 WP_000612080.1.31042 WP_000612080.1.31046 WP_000612080.1.31066 WP_000612080.1.31078 WP_000612080.1.31086 WP_000612080.1.31107 WP_000612080.1.31111 WP_000612080.1.31139 WP_000612080.1.3114 WP_000612080.1.31145 WP_000612080.1.31155 WP_000612080.1.31156 WP_000612080.1.31167 WP_000612080.1.31171 WP_000612080.1.31182 WP_000612080.1.31205 WP_000612080.1.3121 WP_000612080.1.31210 WP_000612080.1.31214 WP_000612080.1.31223 WP_000612080.1.3124 WP_000612080.1.31262 WP_000612080.1.3127 WP_000612080.1.31272 WP_000612080.1.31303 WP_000612080.1.3131 WP_000612080.1.31335 WP_000612080.1.31352 WP_000612080.1.31389 WP_000612080.1.31413 WP_000612080.1.31435 WP_000612080.1.31446 WP_000612080.1.31476 WP_000612080.1.31533 WP_000612080.1.31585 WP_000612080.1.31665 WP_000612080.1.3167 WP_000612080.1.3170 WP_000612080.1.31720 WP_000612080.1.31725 WP_000612080.1.31782 WP_000612080.1.31799 WP_000612080.1.31836 WP_000612080.1.31845 WP_000612080.1.31895 WP_000612080.1.31901 WP_000612080.1.31951 WP_000612080.1.31983 WP_000612080.1.32041 WP_000612080.1.32042 WP_000612080.1.3207 WP_000612080.1.32109 WP_000612080.1.32116 WP_000612080.1.32189 WP_000612080.1.32202 WP_000612080.1.32204 WP_000612080.1.32252 WP_000612080.1.32263 WP_000612080.1.32274 WP_000612080.1.32277 WP_000612080.1.32293 WP_000612080.1.32299 WP_000612080.1.32309 WP_000612080.1.32357 WP_000612080.1.32422 WP_000612080.1.32425 WP_000612080.1.32434 WP_000612080.1.32458 WP_000612080.1.32460 WP_000612080.1.32491 WP_000612080.1.32519 WP_000612080.1.32529 WP_000612080.1.32563 WP_000612080.1.32578 WP_000612080.1.32617 WP_000612080.1.32629 WP_000612080.1.32643 WP_000612080.1.32668 WP_000612080.1.3270 WP_000612080.1.32725 WP_000612080.1.32740 WP_000612080.1.32747 WP_000612080.1.32750 WP_000612080.1.3278 WP_000612080.1.32832 WP_000612080.1.32838 WP_000612080.1.32848 WP_000612080.1.32868 WP_000612080.1.32881 WP_000612080.1.32899 WP_000612080.1.3290 WP_000612080.1.32900 WP_000612080.1.32902 WP_000612080.1.32940 WP_000612080.1.32941 WP_000612080.1.3296 WP_000612080.1.32961 WP_000612080.1.32966 WP_000612080.1.32977 WP_000612080.1.32985 WP_000612080.1.33010 WP_000612080.1.33037 WP_000612080.1.3304 WP_000612080.1.3305 WP_000612080.1.33051 WP_000612080.1.33065 WP_000612080.1.33106 WP_000612080.1.33122 WP_000612080.1.33144 WP_000612080.1.3315 WP_000612080.1.33208 WP_000612080.1.33214 WP_000612080.1.33247 WP_000612080.1.33253 WP_000612080.1.33270 WP_000612080.1.33280 WP_000612080.1.33283 WP_000612080.1.33313 WP_000612080.1.33339 WP_000612080.1.33382 WP_000612080.1.33392 WP_000612080.1.33409 WP_000612080.1.33490 WP_000612080.1.33499 WP_000612080.1.335 WP_000612080.1.33501 WP_000612080.1.33529 WP_000612080.1.3356 WP_000612080.1.33586 WP_000612080.1.33609 WP_000612080.1.3364 WP_000612080.1.33659 WP_000612080.1.33689 WP_000612080.1.3370 WP_000612080.1.33730 WP_000612080.1.33741 WP_000612080.1.33817 WP_000612080.1.33825 WP_000612080.1.33840 WP_000612080.1.33865 WP_000612080.1.33870 WP_000612080.1.3392 WP_000612080.1.33926 WP_000612080.1.3395 WP_000612080.1.33957 WP_000612080.1.3396 WP_000612080.1.33969 WP_000612080.1.33986 WP_000612080.1.34 WP_000612080.1.34001 WP_000612080.1.34022 WP_000612080.1.34059 WP_000612080.1.34084 WP_000612080.1.34091 WP_000612080.1.34107 WP_000612080.1.34118 WP_000612080.1.34179 WP_000612080.1.34185 WP_000612080.1.34211 WP_000612080.1.34214 WP_000612080.1.34234 WP_000612080.1.34259 WP_000612080.1.34284 WP_000612080.1.34292 WP_000612080.1.34330 WP_000612080.1.34376 WP_000612080.1.3438 WP_000612080.1.34382 WP_000612080.1.34431 WP_000612080.1.3445 WP_000612080.1.34454 WP_000612080.1.34458 WP_000612080.1.34484 WP_000612080.1.34496 WP_000612080.1.34517 WP_000612080.1.34530 WP_000612080.1.34614 WP_000612080.1.34659 WP_000612080.1.34665 WP_000612080.1.34684 WP_000612080.1.34694 WP_000612080.1.34711 WP_000612080.1.34745 WP_000612080.1.34751 WP_000612080.1.3476 WP_000612080.1.34808 WP_000612080.1.34817 WP_000612080.1.34820 WP_000612080.1.34824 WP_000612080.1.34834 WP_000612080.1.34854 WP_000612080.1.34881 WP_000612080.1.3489 WP_000612080.1.34932 WP_000612080.1.34962 WP_000612080.1.34972 WP_000612080.1.35001 WP_000612080.1.35035 WP_000612080.1.35040 WP_000612080.1.35074 WP_000612080.1.35075 WP_000612080.1.35175 WP_000612080.1.35240 WP_000612080.1.35274 WP_000612080.1.35298 WP_000612080.1.35321 WP_000612080.1.35332 WP_000612080.1.3541 WP_000612080.1.35460 WP_000612080.1.35494 WP_000612080.1.35532 WP_000612080.1.35560 WP_000612080.1.35563 WP_000612080.1.3557 WP_000612080.1.35570 WP_000612080.1.35594 WP_000612080.1.35619 WP_000612080.1.35624 WP_000612080.1.35628 WP_000612080.1.35648 WP_000612080.1.3566 WP_000612080.1.3570 WP_000612080.1.35712 WP_000612080.1.35713 WP_000612080.1.3572 WP_000612080.1.35736 WP_000612080.1.35777 WP_000612080.1.35791 WP_000612080.1.35795 WP_000612080.1.35809 WP_000612080.1.35835 WP_000612080.1.35868 WP_000612080.1.35870 WP_000612080.1.35887 WP_000612080.1.35916 WP_000612080.1.35936 WP_000612080.1.35938 WP_000612080.1.35961 WP_000612080.1.35966 WP_000612080.1.35993 WP_000612080.1.36000 WP_000612080.1.36034 WP_000612080.1.36036 WP_000612080.1.36037 WP_000612080.1.36063 WP_000612080.1.36069 WP_000612080.1.3610 WP_000612080.1.36157 WP_000612080.1.36172 WP_000612080.1.36229 WP_000612080.1.36232 WP_000612080.1.36236 WP_000612080.1.36291 WP_000612080.1.36298 WP_000612080.1.36308 WP_000612080.1.36323 WP_000612080.1.36343 WP_000612080.1.36409 WP_000612080.1.36425 WP_000612080.1.36445 WP_000612080.1.36460 WP_000612080.1.3649 WP_000612080.1.36495 WP_000612080.1.36512 WP_000612080.1.36526 WP_000612080.1.36542 WP_000612080.1.36564 WP_000612080.1.36567 WP_000612080.1.36579 WP_000612080.1.36584 WP_000612080.1.36592 WP_000612080.1.36617 WP_000612080.1.36618 WP_000612080.1.36643 WP_000612080.1.36663 WP_000612080.1.36685 WP_000612080.1.36701 WP_000612080.1.36721 WP_000612080.1.36725 WP_000612080.1.36764 WP_000612080.1.36765 WP_000612080.1.36779 WP_000612080.1.36792 WP_000612080.1.36798 WP_000612080.1.36802 WP_000612080.1.36821 WP_000612080.1.36853 WP_000612080.1.3688 WP_000612080.1.36885 WP_000612080.1.36889 WP_000612080.1.36950 WP_000612080.1.36978 WP_000612080.1.37013 WP_000612080.1.37014 WP_000612080.1.37021 WP_000612080.1.37029 WP_000612080.1.37063 WP_000612080.1.37100 WP_000612080.1.37114 WP_000612080.1.37133 WP_000612080.1.37147 WP_000612080.1.37158 WP_000612080.1.37176 WP_000612080.1.37191 WP_000612080.1.37199 WP_000612080.1.37200 WP_000612080.1.37258 WP_000612080.1.3726 WP_000612080.1.3728 WP_000612080.1.37297 WP_000612080.1.37303 WP_000612080.1.37320 WP_000612080.1.3734 WP_000612080.1.37363 WP_000612080.1.37405 WP_000612080.1.37478 WP_000612080.1.3748 WP_000612080.1.37513 WP_000612080.1.37521 WP_000612080.1.37558 WP_000612080.1.3756 WP_000612080.1.37584 WP_000612080.1.37590 WP_000612080.1.37593 WP_000612080.1.37600 WP_000612080.1.37610 WP_000612080.1.37613 WP_000612080.1.37659 WP_000612080.1.37662 WP_000612080.1.37666 WP_000612080.1.37675 WP_000612080.1.37691 WP_000612080.1.3771 WP_000612080.1.37719 WP_000612080.1.37761 WP_000612080.1.37775 WP_000612080.1.37777 WP_000612080.1.3778 WP_000612080.1.378 WP_000612080.1.37808 WP_000612080.1.37848 WP_000612080.1.37864 WP_000612080.1.379 WP_000612080.1.3790 WP_000612080.1.37911 WP_000612080.1.37941 WP_000612080.1.37965 WP_000612080.1.37985 WP_000612080.1.38026 WP_000612080.1.38037 WP_000612080.1.38047 WP_000612080.1.38055 WP_000612080.1.38061 WP_000612080.1.38064 WP_000612080.1.38108 WP_000612080.1.38113 WP_000612080.1.3816 WP_000612080.1.38199 WP_000612080.1.38207 WP_000612080.1.38261 WP_000612080.1.38266 WP_000612080.1.38273 WP_000612080.1.3828 WP_000612080.1.38310 WP_000612080.1.3834 WP_000612080.1.38341 WP_000612080.1.38344 WP_000612080.1.38351 WP_000612080.1.3838 WP_000612080.1.38381 WP_000612080.1.38408 WP_000612080.1.38440 WP_000612080.1.38486 WP_000612080.1.38515 WP_000612080.1.38595 WP_000612080.1.3860 WP_000612080.1.38642 WP_000612080.1.38734 WP_000612080.1.38740 WP_000612080.1.38797 WP_000612080.1.38857 WP_000612080.1.38877 WP_000612080.1.38881 WP_000612080.1.38895 WP_000612080.1.38898 WP_000612080.1.38983 WP_000612080.1.38995 WP_000612080.1.38996 WP_000612080.1.39038 WP_000612080.1.39048 WP_000612080.1.39055 WP_000612080.1.39056 WP_000612080.1.39059 WP_000612080.1.39065 WP_000612080.1.3907 WP_000612080.1.39075 WP_000612080.1.39082 WP_000612080.1.39105 WP_000612080.1.39113 WP_000612080.1.3914 WP_000612080.1.39140 WP_000612080.1.39146 WP_000612080.1.39147 WP_000612080.1.39161 WP_000612080.1.39183 WP_000612080.1.39210 WP_000612080.1.39235 WP_000612080.1.3931 WP_000612080.1.39311 WP_000612080.1.39312 WP_000612080.1.39395 WP_000612080.1.39414 WP_000612080.1.39435 WP_000612080.1.39466 WP_000612080.1.39471 WP_000612080.1.39497 WP_000612080.1.39502 WP_000612080.1.39503 WP_000612080.1.39530 WP_000612080.1.39576 WP_000612080.1.39609 WP_000612080.1.39614 WP_000612080.1.39619 WP_000612080.1.39620 WP_000612080.1.39624 WP_000612080.1.39632 WP_000612080.1.39659 WP_000612080.1.39667 WP_000612080.1.39722 WP_000612080.1.39723 WP_000612080.1.39775 WP_000612080.1.39879 WP_000612080.1.39890 WP_000612080.1.39941 WP_000612080.1.39945 WP_000612080.1.39947 WP_000612080.1.40008 WP_000612080.1.40081 WP_000612080.1.40095 WP_000612080.1.40097 WP_000612080.1.401 WP_000612080.1.40111 WP_000612080.1.40155 WP_000612080.1.40158 WP_000612080.1.40160 WP_000612080.1.40167 WP_000612080.1.40170 WP_000612080.1.40171 WP_000612080.1.40205 WP_000612080.1.40224 WP_000612080.1.40229 WP_000612080.1.40258 WP_000612080.1.40279 WP_000612080.1.40284 WP_000612080.1.40307 WP_000612080.1.40361 WP_000612080.1.4042 WP_000612080.1.40467 WP_000612080.1.40492 WP_000612080.1.40493 WP_000612080.1.40496 WP_000612080.1.40508 WP_000612080.1.40517 WP_000612080.1.40528 WP_000612080.1.40533 WP_000612080.1.40577 WP_000612080.1.40583 WP_000612080.1.40605 WP_000612080.1.40622 WP_000612080.1.40648 WP_000612080.1.40693 WP_000612080.1.40695 WP_000612080.1.40698 WP_000612080.1.40745 WP_000612080.1.40750 WP_000612080.1.40763 WP_000612080.1.40771 WP_000612080.1.40788 WP_000612080.1.40849 WP_000612080.1.40854 WP_000612080.1.4089 WP_000612080.1.40910 WP_000612080.1.40924 WP_000612080.1.40930 WP_000612080.1.40932 WP_000612080.1.40946 WP_000612080.1.40973 WP_000612080.1.40979 WP_000612080.1.41004 WP_000612080.1.4106 WP_000612080.1.41070 WP_000612080.1.41074 WP_000612080.1.41075 WP_000612080.1.4109 WP_000612080.1.41097 WP_000612080.1.41116 WP_000612080.1.41128 WP_000612080.1.41132 WP_000612080.1.41176 WP_000612080.1.41192 WP_000612080.1.41225 WP_000612080.1.41251 WP_000612080.1.41258 WP_000612080.1.41265 WP_000612080.1.41277 WP_000612080.1.41305 WP_000612080.1.41308 WP_000612080.1.41321 WP_000612080.1.41333 WP_000612080.1.41335 WP_000612080.1.41345 WP_000612080.1.4136 WP_000612080.1.41375 WP_000612080.1.4141 WP_000612080.1.41415 WP_000612080.1.41427 WP_000612080.1.41434 WP_000612080.1.41459 WP_000612080.1.41468 WP_000612080.1.41498 WP_000612080.1.41519 WP_000612080.1.41524 WP_000612080.1.41528 WP_000612080.1.41593 WP_000612080.1.41610 WP_000612080.1.41628 WP_000612080.1.41631 WP_000612080.1.41658 WP_000612080.1.41659 WP_000612080.1.41688 WP_000612080.1.41690 WP_000612080.1.41716 WP_000612080.1.41746 WP_000612080.1.4178 WP_000612080.1.41799 WP_000612080.1.41824 WP_000612080.1.41825 WP_000612080.1.41836 WP_000612080.1.4184 WP_000612080.1.41862 WP_000612080.1.41877 WP_000612080.1.41894 WP_000612080.1.41897 WP_000612080.1.41911 WP_000612080.1.41919 WP_000612080.1.41929 WP_000612080.1.41931 WP_000612080.1.41938 WP_000612080.1.4194 WP_000612080.1.41949 WP_000612080.1.41978 WP_000612080.1.41994 WP_000612080.1.41998 WP_000612080.1.42009 WP_000612080.1.42069 WP_000612080.1.42081 WP_000612080.1.42090 WP_000612080.1.42111 WP_000612080.1.42136 WP_000612080.1.42187 WP_000612080.1.422 WP_000612080.1.42200 WP_000612080.1.42219 WP_000612080.1.42238 WP_000612080.1.42248 WP_000612080.1.42257 WP_000612080.1.42261 WP_000612080.1.42262 WP_000612080.1.42263 WP_000612080.1.42322 WP_000612080.1.42349 WP_000612080.1.42356 WP_000612080.1.42364 WP_000612080.1.42371 WP_000612080.1.42379 WP_000612080.1.4239 WP_000612080.1.42391 WP_000612080.1.42392 WP_000612080.1.42399 WP_000612080.1.42404 WP_000612080.1.42453 WP_000612080.1.42489 WP_000612080.1.42539 WP_000612080.1.4257 WP_000612080.1.42603 WP_000612080.1.42605 WP_000612080.1.42650 WP_000612080.1.42666 WP_000612080.1.4267 WP_000612080.1.42675 WP_000612080.1.42683 WP_000612080.1.42685 WP_000612080.1.42701 WP_000612080.1.42707 WP_000612080.1.42734 WP_000612080.1.42767 WP_000612080.1.42797 WP_000612080.1.42805 WP_000612080.1.42815 WP_000612080.1.42829 WP_000612080.1.42859 WP_000612080.1.42887 WP_000612080.1.4289 WP_000612080.1.42892 WP_000612080.1.42932 WP_000612080.1.4298 WP_000612080.1.43008 WP_000612080.1.43016 WP_000612080.1.43019 WP_000612080.1.43065 WP_000612080.1.43068 WP_000612080.1.43069 WP_000612080.1.43070 WP_000612080.1.43086 WP_000612080.1.43089 WP_000612080.1.43126 WP_000612080.1.43128 WP_000612080.1.43141 WP_000612080.1.43157 WP_000612080.1.43160 WP_000612080.1.43161 WP_000612080.1.43190 WP_000612080.1.43198 WP_000612080.1.43201 WP_000612080.1.4326 WP_000612080.1.43272 WP_000612080.1.43276 WP_000612080.1.43290 WP_000612080.1.43292 WP_000612080.1.43307 WP_000612080.1.4332 WP_000612080.1.43438 WP_000612080.1.4344 WP_000612080.1.43441 WP_000612080.1.43476 WP_000612080.1.43508 WP_000612080.1.43513 WP_000612080.1.43528 WP_000612080.1.43535 WP_000612080.1.43606 WP_000612080.1.43633 WP_000612080.1.43637 WP_000612080.1.43651 WP_000612080.1.43654 WP_000612080.1.43676 WP_000612080.1.43685 WP_000612080.1.43710 WP_000612080.1.43711 WP_000612080.1.43722 WP_000612080.1.4373 WP_000612080.1.43763 WP_000612080.1.43782 WP_000612080.1.43785 WP_000612080.1.43801 WP_000612080.1.43812 WP_000612080.1.43828 WP_000612080.1.43864 WP_000612080.1.43875 WP_000612080.1.43878 WP_000612080.1.43888 WP_000612080.1.43919 WP_000612080.1.43954 WP_000612080.1.43974 WP_000612080.1.44010 WP_000612080.1.4404 WP_000612080.1.44049 WP_000612080.1.4405 WP_000612080.1.44063 WP_000612080.1.44101 WP_000612080.1.44113 WP_000612080.1.44132 WP_000612080.1.44160 WP_000612080.1.44180 WP_000612080.1.44196 WP_000612080.1.4422 WP_000612080.1.4423 WP_000612080.1.44248 WP_000612080.1.44250 WP_000612080.1.44262 WP_000612080.1.44268 WP_000612080.1.4427 WP_000612080.1.44296 WP_000612080.1.44337 WP_000612080.1.44339 WP_000612080.1.44343 WP_000612080.1.44351 WP_000612080.1.44359 WP_000612080.1.44360 WP_000612080.1.44380 WP_000612080.1.44397 WP_000612080.1.4440 WP_000612080.1.44416 WP_000612080.1.44431 WP_000612080.1.44437 WP_000612080.1.44438 WP_000612080.1.44440 WP_000612080.1.44443 WP_000612080.1.44453 WP_000612080.1.44474 WP_000612080.1.44546 WP_000612080.1.44549 WP_000612080.1.44578 WP_000612080.1.44593 WP_000612080.1.44633 WP_000612080.1.44636 WP_000612080.1.44678 WP_000612080.1.4468 WP_000612080.1.44702 WP_000612080.1.44705 WP_000612080.1.44762 WP_000612080.1.44791 WP_000612080.1.44795 WP_000612080.1.44815 WP_000612080.1.44828 WP_000612080.1.44831 WP_000612080.1.44833 WP_000612080.1.44879 WP_000612080.1.44887 WP_000612080.1.449 WP_000612080.1.44917 WP_000612080.1.44950 WP_000612080.1.44966 WP_000612080.1.44978 WP_000612080.1.44985 WP_000612080.1.44996 WP_000612080.1.44997 WP_000612080.1.4500 WP_000612080.1.4501 WP_000612080.1.45027 WP_000612080.1.45045 WP_000612080.1.45072 WP_000612080.1.45093 WP_000612080.1.45123 WP_000612080.1.45134 WP_000612080.1.45136 WP_000612080.1.45138 WP_000612080.1.45154 WP_000612080.1.45173 WP_000612080.1.45241 WP_000612080.1.45251 WP_000612080.1.45268 WP_000612080.1.45302 WP_000612080.1.4531 WP_000612080.1.45351 WP_000612080.1.4540 WP_000612080.1.45402 WP_000612080.1.45432 WP_000612080.1.45435 WP_000612080.1.45462 WP_000612080.1.45468 WP_000612080.1.45522 WP_000612080.1.45523 WP_000612080.1.45549 WP_000612080.1.45566 WP_000612080.1.45569 WP_000612080.1.45571 WP_000612080.1.45583 WP_000612080.1.45596 WP_000612080.1.45648 WP_000612080.1.45781 WP_000612080.1.45829 WP_000612080.1.45844 WP_000612080.1.45871 WP_000612080.1.45906 WP_000612080.1.45918 WP_000612080.1.4592 WP_000612080.1.46028 WP_000612080.1.46030 WP_000612080.1.46077 WP_000612080.1.46091 WP_000612080.1.46124 WP_000612080.1.46169 WP_000612080.1.46205 WP_000612080.1.46215 WP_000612080.1.46225 WP_000612080.1.46232 WP_000612080.1.46241 WP_000612080.1.46299 WP_000612080.1.46307 WP_000612080.1.46322 WP_000612080.1.46323 WP_000612080.1.46355 WP_000612080.1.46358 WP_000612080.1.464 WP_000612080.1.46406 WP_000612080.1.46444 WP_000612080.1.46454 WP_000612080.1.46461 WP_000612080.1.46499 WP_000612080.1.46504 WP_000612080.1.46505 WP_000612080.1.46551 WP_000612080.1.46559 WP_000612080.1.46572 WP_000612080.1.46578 WP_000612080.1.46620 WP_000612080.1.46637 WP_000612080.1.46701 WP_000612080.1.4671 WP_000612080.1.46726 WP_000612080.1.46730 WP_000612080.1.46732 WP_000612080.1.4674 WP_000612080.1.46781 WP_000612080.1.46816 WP_000612080.1.46842 WP_000612080.1.4686 WP_000612080.1.4690 WP_000612080.1.46920 WP_000612080.1.46945 WP_000612080.1.46961 WP_000612080.1.46967 WP_000612080.1.46976 WP_000612080.1.47005 WP_000612080.1.47014 WP_000612080.1.47036 WP_000612080.1.47037 WP_000612080.1.47042 WP_000612080.1.47059 WP_000612080.1.47085 WP_000612080.1.47123 WP_000612080.1.47215 WP_000612080.1.47245 WP_000612080.1.47257 WP_000612080.1.47442 WP_000612080.1.47460 WP_000612080.1.47506 WP_000612080.1.47507 WP_000612080.1.47523 WP_000612080.1.47531 WP_000612080.1.47532 WP_000612080.1.47567 WP_000612080.1.47576 WP_000612080.1.4758 WP_000612080.1.47605 WP_000612080.1.47614 WP_000612080.1.47630 WP_000612080.1.4769 WP_000612080.1.4770 WP_000612080.1.47714 WP_000612080.1.4774 WP_000612080.1.4775 WP_000612080.1.47756 WP_000612080.1.47767 WP_000612080.1.4781 WP_000612080.1.47817 WP_000612080.1.47829 WP_000612080.1.47849 WP_000612080.1.47850 WP_000612080.1.47875 WP_000612080.1.47886 WP_000612080.1.47898 WP_000612080.1.47911 WP_000612080.1.4795 WP_000612080.1.47988 WP_000612080.1.47992 WP_000612080.1.48019 WP_000612080.1.48100 WP_000612080.1.48114 WP_000612080.1.48139 WP_000612080.1.48190 WP_000612080.1.48215 WP_000612080.1.48244 WP_000612080.1.48268 WP_000612080.1.48292 WP_000612080.1.48324 WP_000612080.1.4839 WP_000612080.1.48399 WP_000612080.1.48426 WP_000612080.1.48430 WP_000612080.1.48436 WP_000612080.1.48455 WP_000612080.1.48493 WP_000612080.1.48586 WP_000612080.1.4859 WP_000612080.1.48591 WP_000612080.1.48610 WP_000612080.1.48631 WP_000612080.1.48647 WP_000612080.1.48651 WP_000612080.1.48663 WP_000612080.1.48690 WP_000612080.1.48734 WP_000612080.1.48751 WP_000612080.1.48755 WP_000612080.1.48756 WP_000612080.1.48774 WP_000612080.1.48778 WP_000612080.1.48797 WP_000612080.1.48849 WP_000612080.1.48855 WP_000612080.1.48886 WP_000612080.1.48896 WP_000612080.1.48908 WP_000612080.1.48955 WP_000612080.1.48963 WP_000612080.1.48973 WP_000612080.1.49004 WP_000612080.1.49005 WP_000612080.1.49012 WP_000612080.1.49090 WP_000612080.1.49102 WP_000612080.1.49106 WP_000612080.1.49117 WP_000612080.1.49121 WP_000612080.1.4914 WP_000612080.1.49140 WP_000612080.1.49153 WP_000612080.1.49162 WP_000612080.1.49166 WP_000612080.1.49175 WP_000612080.1.49214 WP_000612080.1.49226 WP_000612080.1.49276 WP_000612080.1.49304 WP_000612080.1.49309 WP_000612080.1.49311 WP_000612080.1.49334 WP_000612080.1.49355 WP_000612080.1.49429 WP_000612080.1.49434 WP_000612080.1.49450 WP_000612080.1.495 WP_000612080.1.49545 WP_000612080.1.49574 WP_000612080.1.49595 WP_000612080.1.49602 WP_000612080.1.49626 WP_000612080.1.49630 WP_000612080.1.49650 WP_000612080.1.49769 WP_000612080.1.49770 WP_000612080.1.49778 WP_000612080.1.49827 WP_000612080.1.49846 WP_000612080.1.49848 WP_000612080.1.4991 WP_000612080.1.49931 WP_000612080.1.49947 WP_000612080.1.49959 WP_000612080.1.49997 WP_000612080.1.50003 WP_000612080.1.50007 WP_000612080.1.50014 WP_000612080.1.50030 WP_000612080.1.50043 WP_000612080.1.5009 WP_000612080.1.50103 WP_000612080.1.50128 WP_000612080.1.50158 WP_000612080.1.50198 WP_000612080.1.50239 WP_000612080.1.50247 WP_000612080.1.50251 WP_000612080.1.50308 WP_000612080.1.50309 WP_000612080.1.50332 WP_000612080.1.50349 WP_000612080.1.50387 WP_000612080.1.50406 WP_000612080.1.50449 WP_000612080.1.50468 WP_000612080.1.50469 WP_000612080.1.50478 WP_000612080.1.50480 WP_000612080.1.5051 WP_000612080.1.50563 WP_000612080.1.50565 WP_000612080.1.50566 WP_000612080.1.50570 WP_000612080.1.50626 WP_000612080.1.50652 WP_000612080.1.50684 WP_000612080.1.50726 WP_000612080.1.50771 WP_000612080.1.50782 WP_000612080.1.50800 WP_000612080.1.50875 WP_000612080.1.50882 WP_000612080.1.50885 WP_000612080.1.509 WP_000612080.1.50905 WP_000612080.1.50918 WP_000612080.1.50929 WP_000612080.1.50954 WP_000612080.1.50960 WP_000612080.1.50970 WP_000612080.1.51025 WP_000612080.1.51036 WP_000612080.1.51040 WP_000612080.1.51048 WP_000612080.1.51100 WP_000612080.1.51117 WP_000612080.1.51134 WP_000612080.1.51139 WP_000612080.1.5114 WP_000612080.1.51162 WP_000612080.1.51178 WP_000612080.1.51227 WP_000612080.1.5125 WP_000612080.1.5127 WP_000612080.1.51285 WP_000612080.1.51305 WP_000612080.1.51308 WP_000612080.1.51315 WP_000612080.1.51338 WP_000612080.1.51356 WP_000612080.1.5136 WP_000612080.1.5138 WP_000612080.1.51412 WP_000612080.1.51414 WP_000612080.1.51419 WP_000612080.1.51451 WP_000612080.1.51464 WP_000612080.1.51474 WP_000612080.1.51502 WP_000612080.1.51506 WP_000612080.1.51514 WP_000612080.1.51519 WP_000612080.1.51555 WP_000612080.1.51594 WP_000612080.1.51598 WP_000612080.1.51611 WP_000612080.1.51613 WP_000612080.1.51615 WP_000612080.1.51642 WP_000612080.1.51644 WP_000612080.1.51704 WP_000612080.1.51724 WP_000612080.1.51734 WP_000612080.1.51764 WP_000612080.1.51810 WP_000612080.1.51838 WP_000612080.1.51841 WP_000612080.1.51863 WP_000612080.1.51868 WP_000612080.1.51888 WP_000612080.1.51900 WP_000612080.1.51910 WP_000612080.1.51930 WP_000612080.1.51935 WP_000612080.1.51994 WP_000612080.1.520 WP_000612080.1.52047 WP_000612080.1.52057 WP_000612080.1.5211 WP_000612080.1.52114 WP_000612080.1.52123 WP_000612080.1.52129 WP_000612080.1.5216 WP_000612080.1.52161 WP_000612080.1.52191 WP_000612080.1.52202 WP_000612080.1.52209 WP_000612080.1.52255 WP_000612080.1.52301 WP_000612080.1.52321 WP_000612080.1.52339 WP_000612080.1.52446 WP_000612080.1.52456 WP_000612080.1.52469 WP_000612080.1.52528 WP_000612080.1.52571 WP_000612080.1.52582 WP_000612080.1.52586 WP_000612080.1.526 WP_000612080.1.52637 WP_000612080.1.52647 WP_000612080.1.52675 WP_000612080.1.5273 WP_000612080.1.52738 WP_000612080.1.52742 WP_000612080.1.52744 WP_000612080.1.52773 WP_000612080.1.52795 WP_000612080.1.52807 WP_000612080.1.52824 WP_000612080.1.52833 WP_000612080.1.52887 WP_000612080.1.52924 WP_000612080.1.53016 WP_000612080.1.53092 WP_000612080.1.53100 WP_000612080.1.53107 WP_000612080.1.53119 WP_000612080.1.5313 WP_000612080.1.53141 WP_000612080.1.53151 WP_000612080.1.53154 WP_000612080.1.53158 WP_000612080.1.53159 WP_000612080.1.53179 WP_000612080.1.53198 WP_000612080.1.53210 WP_000612080.1.53233 WP_000612080.1.53234 WP_000612080.1.53286 WP_000612080.1.53307 WP_000612080.1.53315 WP_000612080.1.53316 WP_000612080.1.53321 WP_000612080.1.5333 WP_000612080.1.53362 WP_000612080.1.53368 WP_000612080.1.53375 WP_000612080.1.53385 WP_000612080.1.53450 WP_000612080.1.53454 WP_000612080.1.5349 WP_000612080.1.53534 WP_000612080.1.53540 WP_000612080.1.53555 WP_000612080.1.53559 WP_000612080.1.5356 WP_000612080.1.53567 WP_000612080.1.53571 WP_000612080.1.5358 WP_000612080.1.53664 WP_000612080.1.53675 WP_000612080.1.53688 WP_000612080.1.53692 WP_000612080.1.53694 WP_000612080.1.53723 WP_000612080.1.5374 WP_000612080.1.53750 WP_000612080.1.53778 WP_000612080.1.53790 WP_000612080.1.53800 WP_000612080.1.53814 WP_000612080.1.53815 WP_000612080.1.53839 WP_000612080.1.53892 WP_000612080.1.53896 WP_000612080.1.53898 WP_000612080.1.53902 WP_000612080.1.5392 WP_000612080.1.53958 WP_000612080.1.53961 WP_000612080.1.53981 WP_000612080.1.53984 WP_000612080.1.54061 WP_000612080.1.54082 WP_000612080.1.54085 WP_000612080.1.54132 WP_000612080.1.54136 WP_000612080.1.5415 WP_000612080.1.54170 WP_000612080.1.54175 WP_000612080.1.54203 WP_000612080.1.54259 WP_000612080.1.54283 WP_000612080.1.5430 WP_000612080.1.54324 WP_000612080.1.54333 WP_000612080.1.54366 WP_000612080.1.54371 WP_000612080.1.54431 WP_000612080.1.54442 WP_000612080.1.54469 WP_000612080.1.54482 WP_000612080.1.54500 WP_000612080.1.54522 WP_000612080.1.54558 WP_000612080.1.5456 WP_000612080.1.54589 WP_000612080.1.54615 WP_000612080.1.54667 WP_000612080.1.54678 WP_000612080.1.54681 WP_000612080.1.54694 WP_000612080.1.54748 WP_000612080.1.5481 WP_000612080.1.54814 WP_000612080.1.54827 WP_000612080.1.54833 WP_000612080.1.54845 WP_000612080.1.54865 WP_000612080.1.54877 WP_000612080.1.5493 WP_000612080.1.54935 WP_000612080.1.54936 WP_000612080.1.54979 WP_000612080.1.54992 WP_000612080.1.55010 WP_000612080.1.55034 WP_000612080.1.55073 WP_000612080.1.55163 WP_000612080.1.55165 WP_000612080.1.55166 WP_000612080.1.5517 WP_000612080.1.55178 WP_000612080.1.55215 WP_000612080.1.55223 WP_000612080.1.55224 WP_000612080.1.5525 WP_000612080.1.55290 WP_000612080.1.55310 WP_000612080.1.55317 WP_000612080.1.55379 WP_000612080.1.5539 WP_000612080.1.55468 WP_000612080.1.55506 WP_000612080.1.5552 WP_000612080.1.55528 WP_000612080.1.55545 WP_000612080.1.55557 WP_000612080.1.55559 WP_000612080.1.55604 WP_000612080.1.55623 WP_000612080.1.55639 WP_000612080.1.55640 WP_000612080.1.55680 WP_000612080.1.55699 WP_000612080.1.55706 WP_000612080.1.5572 WP_000612080.1.55725 WP_000612080.1.5577 WP_000612080.1.55780 WP_000612080.1.55803 WP_000612080.1.55853 WP_000612080.1.55923 WP_000612080.1.55948 WP_000612080.1.55967 WP_000612080.1.55995 WP_000612080.1.56004 WP_000612080.1.56026 WP_000612080.1.56059 WP_000612080.1.56069 WP_000612080.1.56097 WP_000612080.1.56100 WP_000612080.1.56130 WP_000612080.1.56144 WP_000612080.1.56172 WP_000612080.1.5621 WP_000612080.1.56222 WP_000612080.1.56226 WP_000612080.1.56235 WP_000612080.1.56247 WP_000612080.1.56263 WP_000612080.1.56303 WP_000612080.1.56305 WP_000612080.1.56311 WP_000612080.1.5633 WP_000612080.1.56368 WP_000612080.1.56370 WP_000612080.1.56385 WP_000612080.1.56393 WP_000612080.1.56396 WP_000612080.1.56413 WP_000612080.1.56419 WP_000612080.1.56420 WP_000612080.1.56423 WP_000612080.1.56468 WP_000612080.1.56512 WP_000612080.1.56514 WP_000612080.1.56535 WP_000612080.1.56585 WP_000612080.1.56640 WP_000612080.1.56642 WP_000612080.1.56647 WP_000612080.1.56651 WP_000612080.1.5668 WP_000612080.1.56724 WP_000612080.1.56824 WP_000612080.1.56825 WP_000612080.1.56851 WP_000612080.1.56861 WP_000612080.1.56887 WP_000612080.1.56889 WP_000612080.1.56898 WP_000612080.1.56905 WP_000612080.1.56950 WP_000612080.1.56981 WP_000612080.1.57000 WP_000612080.1.57026 WP_000612080.1.57039 WP_000612080.1.57056 WP_000612080.1.57076 WP_000612080.1.57101 WP_000612080.1.5711 WP_000612080.1.57125 WP_000612080.1.57137 WP_000612080.1.57143 WP_000612080.1.57147 WP_000612080.1.57149 WP_000612080.1.57179 WP_000612080.1.57186 WP_000612080.1.57233 WP_000612080.1.57246 WP_000612080.1.57296 WP_000612080.1.57342 WP_000612080.1.57344 WP_000612080.1.57357 WP_000612080.1.57362 WP_000612080.1.57399 WP_000612080.1.57495 WP_000612080.1.5753 WP_000612080.1.57559 WP_000612080.1.57631 WP_000612080.1.57684 WP_000612080.1.57699 WP_000612080.1.57710 WP_000612080.1.57778 WP_000612080.1.57785 WP_000612080.1.57800 WP_000612080.1.57835 WP_000612080.1.57857 WP_000612080.1.57873 WP_000612080.1.57893 WP_000612080.1.57965 WP_000612080.1.57972 WP_000612080.1.58008 WP_000612080.1.58044 WP_000612080.1.58081 WP_000612080.1.5809 WP_000612080.1.58090 WP_000612080.1.58131 WP_000612080.1.58132 WP_000612080.1.58144 WP_000612080.1.58157 WP_000612080.1.58173 WP_000612080.1.58191 WP_000612080.1.58194 WP_000612080.1.58239 WP_000612080.1.58249 WP_000612080.1.58251 WP_000612080.1.58252 WP_000612080.1.58261 WP_000612080.1.58274 WP_000612080.1.5828 WP_000612080.1.58282 WP_000612080.1.58290 WP_000612080.1.58301 WP_000612080.1.58324 WP_000612080.1.58326 WP_000612080.1.58334 WP_000612080.1.58357 WP_000612080.1.5836 WP_000612080.1.58416 WP_000612080.1.58443 WP_000612080.1.58451 WP_000612080.1.58485 WP_000612080.1.58486 WP_000612080.1.58489 WP_000612080.1.58537 WP_000612080.1.58564 WP_000612080.1.58568 WP_000612080.1.58583 WP_000612080.1.58633 WP_000612080.1.58652 WP_000612080.1.58663 WP_000612080.1.58675 WP_000612080.1.58698 WP_000612080.1.587 WP_000612080.1.58724 WP_000612080.1.58744 WP_000612080.1.58749 WP_000612080.1.5875 WP_000612080.1.5878 WP_000612080.1.58796 WP_000612080.1.58807 WP_000612080.1.58831 WP_000612080.1.58861 WP_000612080.1.58883 WP_000612080.1.58884 WP_000612080.1.58898 WP_000612080.1.58926 WP_000612080.1.58949 WP_000612080.1.58963 WP_000612080.1.58970 WP_000612080.1.58974 WP_000612080.1.59006 WP_000612080.1.59012 WP_000612080.1.59020 WP_000612080.1.59043 WP_000612080.1.59056 WP_000612080.1.59061 WP_000612080.1.59064 WP_000612080.1.59084 WP_000612080.1.59097 WP_000612080.1.59136 WP_000612080.1.59142 WP_000612080.1.59148 WP_000612080.1.59163 WP_000612080.1.59282 WP_000612080.1.5929 WP_000612080.1.59294 WP_000612080.1.59295 WP_000612080.1.59299 WP_000612080.1.59313 WP_000612080.1.59335 WP_000612080.1.59427 WP_000612080.1.59486 WP_000612080.1.5949 WP_000612080.1.59501 WP_000612080.1.59510 WP_000612080.1.59512 WP_000612080.1.59538 WP_000612080.1.59548 WP_000612080.1.59587 WP_000612080.1.59604 WP_000612080.1.59646 WP_000612080.1.59648 WP_000612080.1.5969 WP_000612080.1.59709 WP_000612080.1.59751 WP_000612080.1.59755 WP_000612080.1.59827 WP_000612080.1.59829 WP_000612080.1.59847 WP_000612080.1.59848 WP_000612080.1.59863 WP_000612080.1.59928 WP_000612080.1.5993 WP_000612080.1.59969 WP_000612080.1.59979 WP_000612080.1.59994 WP_000612080.1.60015 WP_000612080.1.60045 WP_000612080.1.60076 WP_000612080.1.60106 WP_000612080.1.60114 WP_000612080.1.60126 WP_000612080.1.60137 WP_000612080.1.60154 WP_000612080.1.60168 WP_000612080.1.60192 WP_000612080.1.60199 WP_000612080.1.60209 WP_000612080.1.60212 WP_000612080.1.60226 WP_000612080.1.60253 WP_000612080.1.60320 WP_000612080.1.60322 WP_000612080.1.60324 WP_000612080.1.6033 WP_000612080.1.60330 WP_000612080.1.60356 WP_000612080.1.6038 WP_000612080.1.60380 WP_000612080.1.6041 WP_000612080.1.60424 WP_000612080.1.60425 WP_000612080.1.60481 WP_000612080.1.605 WP_000612080.1.60503 WP_000612080.1.60560 WP_000612080.1.6058 WP_000612080.1.60584 WP_000612080.1.6060 WP_000612080.1.60608 WP_000612080.1.60622 WP_000612080.1.60643 WP_000612080.1.60661 WP_000612080.1.60676 WP_000612080.1.60708 WP_000612080.1.60713 WP_000612080.1.60725 WP_000612080.1.60746 WP_000612080.1.60760 WP_000612080.1.60783 WP_000612080.1.60792 WP_000612080.1.608 WP_000612080.1.60807 WP_000612080.1.60838 WP_000612080.1.60851 WP_000612080.1.60855 WP_000612080.1.60857 WP_000612080.1.60863 WP_000612080.1.60866 WP_000612080.1.60882 WP_000612080.1.60889 WP_000612080.1.60897 WP_000612080.1.6090 WP_000612080.1.60926 WP_000612080.1.60950 WP_000612080.1.60990 WP_000612080.1.6104 WP_000612080.1.61044 WP_000612080.1.61076 WP_000612080.1.6108 WP_000612080.1.61114 WP_000612080.1.61123 WP_000612080.1.61146 WP_000612080.1.61147 WP_000612080.1.61168 WP_000612080.1.61184 WP_000612080.1.61200 WP_000612080.1.61210 WP_000612080.1.61233 WP_000612080.1.61356 WP_000612080.1.61357 WP_000612080.1.61381 WP_000612080.1.61434 WP_000612080.1.61501 WP_000612080.1.61509 WP_000612080.1.61511 WP_000612080.1.61519 WP_000612080.1.61539 WP_000612080.1.61542 WP_000612080.1.61553 WP_000612080.1.61594 WP_000612080.1.61595 WP_000612080.1.61649 WP_000612080.1.61652 WP_000612080.1.61662 WP_000612080.1.61667 WP_000612080.1.61671 WP_000612080.1.61697 WP_000612080.1.61732 WP_000612080.1.61737 WP_000612080.1.61809 WP_000612080.1.61877 WP_000612080.1.6190 WP_000612080.1.61908 WP_000612080.1.61920 WP_000612080.1.61922 WP_000612080.1.61924 WP_000612080.1.62076 WP_000612080.1.6210 WP_000612080.1.62108 WP_000612080.1.62124 WP_000612080.1.62142 WP_000612080.1.62144 WP_000612080.1.62158 WP_000612080.1.62199 WP_000612080.1.62201 WP_000612080.1.62210 WP_000612080.1.62219 WP_000612080.1.62222 WP_000612080.1.62223 WP_000612080.1.62241 WP_000612080.1.62245 WP_000612080.1.62271 WP_000612080.1.62302 WP_000612080.1.62310 WP_000612080.1.62314 WP_000612080.1.62323 WP_000612080.1.62333 WP_000612080.1.62338 WP_000612080.1.62339 WP_000612080.1.62344 WP_000612080.1.62380 WP_000612080.1.62404 WP_000612080.1.62411 WP_000612080.1.62412 WP_000612080.1.62436 WP_000612080.1.62475 WP_000612080.1.62486 WP_000612080.1.62488 WP_000612080.1.62504 WP_000612080.1.62536 WP_000612080.1.62619 WP_000612080.1.62640 WP_000612080.1.62648 WP_000612080.1.62686 WP_000612080.1.62693 WP_000612080.1.627 WP_000612080.1.62725 WP_000612080.1.62745 WP_000612080.1.62751 WP_000612080.1.62757 WP_000612080.1.62798 WP_000612080.1.62825 WP_000612080.1.62828 WP_000612080.1.62913 WP_000612080.1.62932 WP_000612080.1.62960 WP_000612080.1.62983 WP_000612080.1.62988 WP_000612080.1.63016 WP_000612080.1.63025 WP_000612080.1.63043 WP_000612080.1.63045 WP_000612080.1.63069 WP_000612080.1.63087 WP_000612080.1.63102 WP_000612080.1.63118 WP_000612080.1.63135 WP_000612080.1.63150 WP_000612080.1.63155 WP_000612080.1.63169 WP_000612080.1.63186 WP_000612080.1.63229 WP_000612080.1.63234 WP_000612080.1.63243 WP_000612080.1.63250 WP_000612080.1.63297 WP_000612080.1.63358 WP_000612080.1.63422 WP_000612080.1.63448 WP_000612080.1.63497 WP_000612080.1.63509 WP_000612080.1.63513 WP_000612080.1.63514 WP_000612080.1.63529 WP_000612080.1.63532 WP_000612080.1.63568 WP_000612080.1.63583 WP_000612080.1.63585 WP_000612080.1.63592 WP_000612080.1.63603 WP_000612080.1.63633 WP_000612080.1.63663 WP_000612080.1.6367 WP_000612080.1.63677 WP_000612080.1.63690 WP_000612080.1.6370 WP_000612080.1.63731 WP_000612080.1.63736 WP_000612080.1.63748 WP_000612080.1.63782 WP_000612080.1.63816 WP_000612080.1.63831 WP_000612080.1.63851 WP_000612080.1.63860 WP_000612080.1.63863 WP_000612080.1.63864 WP_000612080.1.63866 WP_000612080.1.63876 WP_000612080.1.6389 WP_000612080.1.63901 WP_000612080.1.63903 WP_000612080.1.63912 WP_000612080.1.63955 WP_000612080.1.63958 WP_000612080.1.63963 WP_000612080.1.63977 WP_000612080.1.63992 WP_000612080.1.64010 WP_000612080.1.64032 WP_000612080.1.64034 WP_000612080.1.64072 WP_000612080.1.64085 WP_000612080.1.64087 WP_000612080.1.64109 WP_000612080.1.64121 WP_000612080.1.6415 WP_000612080.1.64157 WP_000612080.1.64208 WP_000612080.1.64217 WP_000612080.1.64229 WP_000612080.1.64242 WP_000612080.1.64266 WP_000612080.1.64293 WP_000612080.1.64294 WP_000612080.1.64332 WP_000612080.1.64350 WP_000612080.1.6437 WP_000612080.1.64374 WP_000612080.1.64376 WP_000612080.1.64385 WP_000612080.1.644 WP_000612080.1.64462 WP_000612080.1.64471 WP_000612080.1.64500 WP_000612080.1.64501 WP_000612080.1.6451 WP_000612080.1.64538 WP_000612080.1.64597 WP_000612080.1.64632 WP_000612080.1.64645 WP_000612080.1.64648 WP_000612080.1.64654 WP_000612080.1.64662 WP_000612080.1.64663 WP_000612080.1.64667 WP_000612080.1.64674 WP_000612080.1.64690 WP_000612080.1.64709 WP_000612080.1.64710 WP_000612080.1.64711 WP_000612080.1.64744 WP_000612080.1.64763 WP_000612080.1.64771 WP_000612080.1.64798 WP_000612080.1.64817 WP_000612080.1.64847 WP_000612080.1.6487 WP_000612080.1.64891 WP_000612080.1.64919 WP_000612080.1.64944 WP_000612080.1.64974 WP_000612080.1.64977 WP_000612080.1.65011 WP_000612080.1.65016 WP_000612080.1.65054 WP_000612080.1.65075 WP_000612080.1.6514 WP_000612080.1.65163 WP_000612080.1.65168 WP_000612080.1.65172 WP_000612080.1.65185 WP_000612080.1.65191 WP_000612080.1.65200 WP_000612080.1.65211 WP_000612080.1.65218 WP_000612080.1.65226 WP_000612080.1.65238 WP_000612080.1.65249 WP_000612080.1.6525 WP_000612080.1.65266 WP_000612080.1.65357 WP_000612080.1.65363 WP_000612080.1.65394 WP_000612080.1.65395 WP_000612080.1.65459 WP_000612080.1.65463 WP_000612080.1.65487 WP_000612080.1.6549 WP_000612080.1.65499 WP_000612080.1.6550 WP_000612080.1.65508 WP_000612080.1.65538 WP_000612080.1.6554 WP_000612080.1.65601 WP_000612080.1.6561 WP_000612080.1.65650 WP_000612080.1.65697 WP_000612080.1.65698 WP_000612080.1.65699 WP_000612080.1.6572 WP_000612080.1.65737 WP_000612080.1.65755 WP_000612080.1.65771 WP_000612080.1.65790 WP_000612080.1.65795 WP_000612080.1.65812 WP_000612080.1.65838 WP_000612080.1.65846 WP_000612080.1.65849 WP_000612080.1.65863 WP_000612080.1.65876 WP_000612080.1.65881 WP_000612080.1.65883 WP_000612080.1.65901 WP_000612080.1.6594 WP_000612080.1.6595 WP_000612080.1.65985 WP_000612080.1.66021 WP_000612080.1.66031 WP_000612080.1.66052 WP_000612080.1.66064 WP_000612080.1.66085 WP_000612080.1.66109 WP_000612080.1.66122 WP_000612080.1.66129 WP_000612080.1.66145 WP_000612080.1.66167 WP_000612080.1.66171 WP_000612080.1.66183 WP_000612080.1.6620 WP_000612080.1.66216 WP_000612080.1.66234 WP_000612080.1.66235 WP_000612080.1.66250 WP_000612080.1.66270 WP_000612080.1.66272 WP_000612080.1.66273 WP_000612080.1.66289 WP_000612080.1.66315 WP_000612080.1.66324 WP_000612080.1.6634 WP_000612080.1.66361 WP_000612080.1.66365 WP_000612080.1.66385 WP_000612080.1.66400 WP_000612080.1.66428 WP_000612080.1.66446 WP_000612080.1.6647 WP_000612080.1.66480 WP_000612080.1.66492 WP_000612080.1.66506 WP_000612080.1.66534 WP_000612080.1.66539 WP_000612080.1.66600 WP_000612080.1.66630 WP_000612080.1.66665 WP_000612080.1.66681 WP_000612080.1.66684 WP_000612080.1.66702 WP_000612080.1.66733 WP_000612080.1.66755 WP_000612080.1.66759 WP_000612080.1.66801 WP_000612080.1.66807 WP_000612080.1.66820 WP_000612080.1.66824 WP_000612080.1.66860 WP_000612080.1.66937 WP_000612080.1.66953 WP_000612080.1.66955 WP_000612080.1.66959 WP_000612080.1.66981 WP_000612080.1.67 WP_000612080.1.67024 WP_000612080.1.67042 WP_000612080.1.67075 WP_000612080.1.6710 WP_000612080.1.67101 WP_000612080.1.67143 WP_000612080.1.67173 WP_000612080.1.67175 WP_000612080.1.67184 WP_000612080.1.67201 WP_000612080.1.67211 WP_000612080.1.67237 WP_000612080.1.67279 WP_000612080.1.67336 WP_000612080.1.67339 WP_000612080.1.67374 WP_000612080.1.67387 WP_000612080.1.67394 WP_000612080.1.67397 WP_000612080.1.67403 WP_000612080.1.67405 WP_000612080.1.67424 WP_000612080.1.67430 WP_000612080.1.67442 WP_000612080.1.67539 WP_000612080.1.67556 WP_000612080.1.67576 WP_000612080.1.6760 WP_000612080.1.67603 WP_000612080.1.67604 WP_000612080.1.67619 WP_000612080.1.67625 WP_000612080.1.67627 WP_000612080.1.67641 WP_000612080.1.67657 WP_000612080.1.67673 WP_000612080.1.67700 WP_000612080.1.67707 WP_000612080.1.67718 WP_000612080.1.67729 WP_000612080.1.67731 WP_000612080.1.67772 WP_000612080.1.67774 WP_000612080.1.67803 WP_000612080.1.67814 WP_000612080.1.6782 WP_000612080.1.67820 WP_000612080.1.67827 WP_000612080.1.6785 WP_000612080.1.67905 WP_000612080.1.67910 WP_000612080.1.67924 WP_000612080.1.67932 WP_000612080.1.67954 WP_000612080.1.67969 WP_000612080.1.67970 WP_000612080.1.68 WP_000612080.1.68036 WP_000612080.1.68043 WP_000612080.1.6809 WP_000612080.1.68105 WP_000612080.1.68113 WP_000612080.1.68131 WP_000612080.1.68140 WP_000612080.1.68147 WP_000612080.1.68159 WP_000612080.1.68182 WP_000612080.1.6819 WP_000612080.1.68285 WP_000612080.1.6833 WP_000612080.1.68359 WP_000612080.1.68420 WP_000612080.1.68478 WP_000612080.1.685 WP_000612080.1.68514 WP_000612080.1.68564 WP_000612080.1.6857 WP_000612080.1.6858 WP_000612080.1.68652 WP_000612080.1.68658 WP_000612080.1.68677 WP_000612080.1.68688 WP_000612080.1.68690 WP_000612080.1.68742 WP_000612080.1.6875 WP_000612080.1.68770 WP_000612080.1.68809 WP_000612080.1.68818 WP_000612080.1.6882 WP_000612080.1.6883 WP_000612080.1.68893 WP_000612080.1.68895 WP_000612080.1.68914 WP_000612080.1.68958 WP_000612080.1.68966 WP_000612080.1.68999 WP_000612080.1.69029 WP_000612080.1.6905 WP_000612080.1.69053 WP_000612080.1.69058 WP_000612080.1.69080 WP_000612080.1.69086 WP_000612080.1.69131 WP_000612080.1.69170 WP_000612080.1.69210 WP_000612080.1.69236 WP_000612080.1.69270 WP_000612080.1.69273 WP_000612080.1.69282 WP_000612080.1.69288 WP_000612080.1.69296 WP_000612080.1.69346 WP_000612080.1.69357 WP_000612080.1.69371 WP_000612080.1.69376 WP_000612080.1.69396 WP_000612080.1.69465 WP_000612080.1.69466 WP_000612080.1.69485 WP_000612080.1.69554 WP_000612080.1.69575 WP_000612080.1.69611 WP_000612080.1.69616 WP_000612080.1.69642 WP_000612080.1.69656 WP_000612080.1.69657 WP_000612080.1.69690 WP_000612080.1.69696 WP_000612080.1.69767 WP_000612080.1.69785 WP_000612080.1.69787 WP_000612080.1.69790 WP_000612080.1.69807 WP_000612080.1.69808 WP_000612080.1.69817 WP_000612080.1.69848 WP_000612080.1.69923 WP_000612080.1.69948 WP_000612080.1.69953 WP_000612080.1.69965 WP_000612080.1.69975 WP_000612080.1.69977 WP_000612080.1.70003 WP_000612080.1.70010 WP_000612080.1.70028 WP_000612080.1.70049 WP_000612080.1.70058 WP_000612080.1.70061 WP_000612080.1.70087 WP_000612080.1.70088 WP_000612080.1.7010 WP_000612080.1.7014 WP_000612080.1.7016 WP_000612080.1.70169 WP_000612080.1.70183 WP_000612080.1.70205 WP_000612080.1.70240 WP_000612080.1.70248 WP_000612080.1.70249 WP_000612080.1.70261 WP_000612080.1.70272 WP_000612080.1.70281 WP_000612080.1.70303 WP_000612080.1.70314 WP_000612080.1.70326 WP_000612080.1.70327 WP_000612080.1.7033 WP_000612080.1.70355 WP_000612080.1.70427 WP_000612080.1.70433 WP_000612080.1.7044 WP_000612080.1.70440 WP_000612080.1.70523 WP_000612080.1.70531 WP_000612080.1.70545 WP_000612080.1.70547 WP_000612080.1.7055 WP_000612080.1.70596 WP_000612080.1.70623 WP_000612080.1.70644 WP_000612080.1.70671 WP_000612080.1.70678 WP_000612080.1.70679 WP_000612080.1.70685 WP_000612080.1.70708 WP_000612080.1.70712 WP_000612080.1.70717 WP_000612080.1.70731 WP_000612080.1.70733 WP_000612080.1.70761 WP_000612080.1.70772 WP_000612080.1.70785 WP_000612080.1.70792 WP_000612080.1.70797 WP_000612080.1.70837 WP_000612080.1.70845 WP_000612080.1.70846 WP_000612080.1.70899 WP_000612080.1.70914 WP_000612080.1.70929 WP_000612080.1.7093 WP_000612080.1.70969 WP_000612080.1.70977 WP_000612080.1.70981 WP_000612080.1.70985 WP_000612080.1.70986 WP_000612080.1.70995 WP_000612080.1.71039 WP_000612080.1.71057 WP_000612080.1.71081 WP_000612080.1.71088 WP_000612080.1.7110 WP_000612080.1.71117 WP_000612080.1.71150 WP_000612080.1.71172 WP_000612080.1.71184 WP_000612080.1.71186 WP_000612080.1.71201 WP_000612080.1.71248 WP_000612080.1.71268 WP_000612080.1.71299 WP_000612080.1.71305 WP_000612080.1.714 WP_000612080.1.71407 WP_000612080.1.7142 WP_000612080.1.71450 WP_000612080.1.71455 WP_000612080.1.71456 WP_000612080.1.71481 WP_000612080.1.71487 WP_000612080.1.71500 WP_000612080.1.71523 WP_000612080.1.71542 WP_000612080.1.71566 WP_000612080.1.71583 WP_000612080.1.71600 WP_000612080.1.71626 WP_000612080.1.71640 WP_000612080.1.71649 WP_000612080.1.71651 WP_000612080.1.71653 WP_000612080.1.71716 WP_000612080.1.71746 WP_000612080.1.71872 WP_000612080.1.71929 WP_000612080.1.71941 WP_000612080.1.71950 WP_000612080.1.71954 WP_000612080.1.71979 WP_000612080.1.71984 WP_000612080.1.71985 WP_000612080.1.720 WP_000612080.1.72003 WP_000612080.1.72065 WP_000612080.1.72073 WP_000612080.1.72100 WP_000612080.1.72107 WP_000612080.1.72119 WP_000612080.1.72182 WP_000612080.1.72188 WP_000612080.1.72190 WP_000612080.1.72221 WP_000612080.1.72234 WP_000612080.1.72243 WP_000612080.1.72269 WP_000612080.1.72277 WP_000612080.1.72281 WP_000612080.1.72300 WP_000612080.1.72325 WP_000612080.1.72339 WP_000612080.1.72350 WP_000612080.1.72351 WP_000612080.1.72382 WP_000612080.1.72383 WP_000612080.1.72438 WP_000612080.1.72461 WP_000612080.1.72470 WP_000612080.1.72527 WP_000612080.1.72532 WP_000612080.1.7255 WP_000612080.1.72602 WP_000612080.1.72625 WP_000612080.1.72629 WP_000612080.1.72631 WP_000612080.1.72638 WP_000612080.1.72642 WP_000612080.1.72667 WP_000612080.1.72671 WP_000612080.1.72674 WP_000612080.1.72689 WP_000612080.1.72716 WP_000612080.1.72718 WP_000612080.1.72724 WP_000612080.1.72789 WP_000612080.1.72793 WP_000612080.1.72827 WP_000612080.1.72828 WP_000612080.1.72843 WP_000612080.1.72850 WP_000612080.1.72865 WP_000612080.1.72872 WP_000612080.1.72892 WP_000612080.1.72894 WP_000612080.1.72896 WP_000612080.1.72897 WP_000612080.1.7295 WP_000612080.1.72969 WP_000612080.1.72987 WP_000612080.1.7304 WP_000612080.1.73052 WP_000612080.1.73068 WP_000612080.1.7311 WP_000612080.1.73114 WP_000612080.1.73144 WP_000612080.1.73164 WP_000612080.1.73177 WP_000612080.1.73180 WP_000612080.1.73258 WP_000612080.1.73270 WP_000612080.1.73285 WP_000612080.1.7332 WP_000612080.1.7333 WP_000612080.1.73352 WP_000612080.1.73389 WP_000612080.1.73425 WP_000612080.1.73488 WP_000612080.1.73504 WP_000612080.1.73512 WP_000612080.1.7353 WP_000612080.1.73535 WP_000612080.1.73544 WP_000612080.1.73598 WP_000612080.1.7361 WP_000612080.1.73648 WP_000612080.1.73708 WP_000612080.1.73764 WP_000612080.1.73768 WP_000612080.1.73804 WP_000612080.1.73849 WP_000612080.1.7386 WP_000612080.1.7394 WP_000612080.1.73945 WP_000612080.1.73948 WP_000612080.1.73999 WP_000612080.1.74024 WP_000612080.1.74030 WP_000612080.1.74038 WP_000612080.1.74040 WP_000612080.1.74043 WP_000612080.1.74049 WP_000612080.1.7405 WP_000612080.1.74058 WP_000612080.1.74070 WP_000612080.1.74077 WP_000612080.1.74089 WP_000612080.1.74117 WP_000612080.1.74135 WP_000612080.1.74174 WP_000612080.1.74207 WP_000612080.1.74214 WP_000612080.1.74228 WP_000612080.1.74241 WP_000612080.1.74248 WP_000612080.1.74285 WP_000612080.1.743 WP_000612080.1.7430 WP_000612080.1.74300 WP_000612080.1.74317 WP_000612080.1.74414 WP_000612080.1.74415 WP_000612080.1.74418 WP_000612080.1.74422 WP_000612080.1.74428 WP_000612080.1.7444 WP_000612080.1.74454 WP_000612080.1.74469 WP_000612080.1.74481 WP_000612080.1.74500 WP_000612080.1.74570 WP_000612080.1.74578 WP_000612080.1.74616 WP_000612080.1.74620 WP_000612080.1.74621 WP_000612080.1.74639 WP_000612080.1.74644 WP_000612080.1.74647 WP_000612080.1.74661 WP_000612080.1.74677 WP_000612080.1.74699 WP_000612080.1.74702 WP_000612080.1.74757 WP_000612080.1.74806 WP_000612080.1.74807 WP_000612080.1.74826 WP_000612080.1.74831 WP_000612080.1.74876 WP_000612080.1.74894 WP_000612080.1.74929 WP_000612080.1.74939 WP_000612080.1.74972 WP_000612080.1.74973 WP_000612080.1.74992 WP_000612080.1.74996 WP_000612080.1.75009 WP_000612080.1.75051 WP_000612080.1.75056 WP_000612080.1.7507 WP_000612080.1.75089 WP_000612080.1.75114 WP_000612080.1.75116 WP_000612080.1.75134 WP_000612080.1.75148 WP_000612080.1.75159 WP_000612080.1.75177 WP_000612080.1.75180 WP_000612080.1.75237 WP_000612080.1.75273 WP_000612080.1.75296 WP_000612080.1.75301 WP_000612080.1.7531 WP_000612080.1.75400 WP_000612080.1.75413 WP_000612080.1.7543 WP_000612080.1.75433 WP_000612080.1.75450 WP_000612080.1.75494 WP_000612080.1.75532 WP_000612080.1.75565 WP_000612080.1.7558 WP_000612080.1.75585 WP_000612080.1.75593 WP_000612080.1.75607 WP_000612080.1.75609 WP_000612080.1.75610 WP_000612080.1.75626 WP_000612080.1.75633 WP_000612080.1.75716 WP_000612080.1.75718 WP_000612080.1.75740 WP_000612080.1.75745 WP_000612080.1.75751 WP_000612080.1.75793 WP_000612080.1.75794 WP_000612080.1.75810 WP_000612080.1.75828 WP_000612080.1.75844 WP_000612080.1.75863 WP_000612080.1.75886 WP_000612080.1.75898 WP_000612080.1.75902 WP_000612080.1.75932 WP_000612080.1.75957 WP_000612080.1.76055 WP_000612080.1.76081 WP_000612080.1.76108 WP_000612080.1.76116 WP_000612080.1.76122 WP_000612080.1.76137 WP_000612080.1.76156 WP_000612080.1.76208 WP_000612080.1.76256 WP_000612080.1.76301 WP_000612080.1.76339 WP_000612080.1.7634 WP_000612080.1.76345 WP_000612080.1.76366 WP_000612080.1.76417 WP_000612080.1.76434 WP_000612080.1.76451 WP_000612080.1.7646 WP_000612080.1.76471 WP_000612080.1.76495 WP_000612080.1.76510 WP_000612080.1.76548 WP_000612080.1.76558 WP_000612080.1.7657 WP_000612080.1.76572 WP_000612080.1.76576 WP_000612080.1.76611 WP_000612080.1.76641 WP_000612080.1.76651 WP_000612080.1.76653 WP_000612080.1.7672 WP_000612080.1.76724 WP_000612080.1.76738 WP_000612080.1.76776 WP_000612080.1.76788 WP_000612080.1.76799 WP_000612080.1.7684 WP_000612080.1.76854 WP_000612080.1.76866 WP_000612080.1.76913 WP_000612080.1.76916 WP_000612080.1.76932 WP_000612080.1.76968 WP_000612080.1.76973 WP_000612080.1.76988 WP_000612080.1.77016 WP_000612080.1.77017 WP_000612080.1.77033 WP_000612080.1.77067 WP_000612080.1.77087 WP_000612080.1.77090 WP_000612080.1.77111 WP_000612080.1.77193 WP_000612080.1.77241 WP_000612080.1.77271 WP_000612080.1.77299 WP_000612080.1.77306 WP_000612080.1.77313 WP_000612080.1.77356 WP_000612080.1.77384 WP_000612080.1.77390 WP_000612080.1.77436 WP_000612080.1.77475 WP_000612080.1.77496 WP_000612080.1.77501 WP_000612080.1.77512 WP_000612080.1.77513 WP_000612080.1.77543 WP_000612080.1.77555 WP_000612080.1.77563 WP_000612080.1.77596 WP_000612080.1.77646 WP_000612080.1.77702 WP_000612080.1.77713 WP_000612080.1.7772 WP_000612080.1.77729 WP_000612080.1.77754 WP_000612080.1.77761 WP_000612080.1.77825 WP_000612080.1.77837 WP_000612080.1.77846 WP_000612080.1.77871 WP_000612080.1.77900 WP_000612080.1.7792 WP_000612080.1.77923 WP_000612080.1.7793 WP_000612080.1.77951 WP_000612080.1.77971 WP_000612080.1.77975 WP_000612080.1.77983 WP_000612080.1.77987 WP_000612080.1.77989 WP_000612080.1.78 WP_000612080.1.78016 WP_000612080.1.7802 WP_000612080.1.78035 WP_000612080.1.78048 WP_000612080.1.78051 WP_000612080.1.78053 WP_000612080.1.78107 WP_000612080.1.7814 WP_000612080.1.78166 WP_000612080.1.78168 WP_000612080.1.78170 WP_000612080.1.78180 WP_000612080.1.78192 WP_000612080.1.78195 WP_000612080.1.78245 WP_000612080.1.78291 WP_000612080.1.78301 WP_000612080.1.78309 WP_000612080.1.78320 WP_000612080.1.78366 WP_000612080.1.78382 WP_000612080.1.78388 WP_000612080.1.78410 WP_000612080.1.78443 WP_000612080.1.78501 WP_000612080.1.78502 WP_000612080.1.78602 WP_000612080.1.78603 WP_000612080.1.7862 WP_000612080.1.78626 WP_000612080.1.78632 WP_000612080.1.78658 WP_000612080.1.78661 WP_000612080.1.78674 WP_000612080.1.78676 WP_000612080.1.78697 WP_000612080.1.78715 WP_000612080.1.78734 WP_000612080.1.78738 WP_000612080.1.78761 WP_000612080.1.7877 WP_000612080.1.78771 WP_000612080.1.78789 WP_000612080.1.78815 WP_000612080.1.78862 WP_000612080.1.78877 WP_000612080.1.78881 WP_000612080.1.78896 WP_000612080.1.789 WP_000612080.1.7891 WP_000612080.1.78913 WP_000612080.1.78928 WP_000612080.1.78951 WP_000612080.1.78993 WP_000612080.1.79011 WP_000612080.1.79012 WP_000612080.1.79032 WP_000612080.1.79069 WP_000612080.1.79074 WP_000612080.1.79098 WP_000612080.1.79099 WP_000612080.1.79155 WP_000612080.1.79164 WP_000612080.1.79189 WP_000612080.1.79204 WP_000612080.1.79235 WP_000612080.1.79280 WP_000612080.1.79289 WP_000612080.1.79297 WP_000612080.1.79302 WP_000612080.1.79397 WP_000612080.1.794 WP_000612080.1.79456 WP_000612080.1.79468 WP_000612080.1.79532 WP_000612080.1.79547 WP_000612080.1.7956 WP_000612080.1.79580 WP_000612080.1.79586 WP_000612080.1.79635 WP_000612080.1.79645 WP_000612080.1.79654 WP_000612080.1.7970 WP_000612080.1.7972 WP_000612080.1.79722 WP_000612080.1.79738 WP_000612080.1.79757 WP_000612080.1.79772 WP_000612080.1.79778 WP_000612080.1.7979 WP_000612080.1.7982 WP_000612080.1.79832 WP_000612080.1.79880 WP_000612080.1.7991 WP_000612080.1.79914 WP_000612080.1.79934 WP_000612080.1.7994 WP_000612080.1.79951 WP_000612080.1.79966 WP_000612080.1.79974 WP_000612080.1.79996 WP_000612080.1.80103 WP_000612080.1.80229 WP_000612080.1.8024 WP_000612080.1.80249 WP_000612080.1.80250 WP_000612080.1.80254 WP_000612080.1.80273 WP_000612080.1.80282 WP_000612080.1.80293 WP_000612080.1.80307 WP_000612080.1.80354 WP_000612080.1.80368 WP_000612080.1.80380 WP_000612080.1.80386 WP_000612080.1.80400 WP_000612080.1.80441 WP_000612080.1.80448 WP_000612080.1.80462 WP_000612080.1.80473 WP_000612080.1.80479 WP_000612080.1.80480 WP_000612080.1.8049 WP_000612080.1.80492 WP_000612080.1.80496 WP_000612080.1.80569 WP_000612080.1.80586 WP_000612080.1.80609 WP_000612080.1.80651 WP_000612080.1.80664 WP_000612080.1.80667 WP_000612080.1.80674 WP_000612080.1.80696 WP_000612080.1.80707 WP_000612080.1.80723 WP_000612080.1.80725 WP_000612080.1.80750 WP_000612080.1.80757 WP_000612080.1.80760 WP_000612080.1.80803 WP_000612080.1.80840 WP_000612080.1.80874 WP_000612080.1.80876 WP_000612080.1.80913 WP_000612080.1.80973 WP_000612080.1.80984 WP_000612080.1.8106 WP_000612080.1.81109 WP_000612080.1.81110 WP_000612080.1.81118 WP_000612080.1.81131 WP_000612080.1.81187 WP_000612080.1.81197 WP_000612080.1.81225 WP_000612080.1.81262 WP_000612080.1.81268 WP_000612080.1.81269 WP_000612080.1.8127 WP_000612080.1.81271 WP_000612080.1.8130 WP_000612080.1.8131 WP_000612080.1.81321 WP_000612080.1.81333 WP_000612080.1.8134 WP_000612080.1.81342 WP_000612080.1.81364 WP_000612080.1.81388 WP_000612080.1.81404 WP_000612080.1.81455 WP_000612080.1.81472 WP_000612080.1.81494 WP_000612080.1.81504 WP_000612080.1.81557 WP_000612080.1.81667 WP_000612080.1.81668 WP_000612080.1.81676 WP_000612080.1.81681 WP_000612080.1.8170 WP_000612080.1.81736 WP_000612080.1.81743 WP_000612080.1.81763 WP_000612080.1.81768 WP_000612080.1.81855 WP_000612080.1.81921 WP_000612080.1.81931 WP_000612080.1.81936 WP_000612080.1.81941 WP_000612080.1.81949 WP_000612080.1.81977 WP_000612080.1.81995 WP_000612080.1.82070 WP_000612080.1.82076 WP_000612080.1.82099 WP_000612080.1.82131 WP_000612080.1.82141 WP_000612080.1.82149 WP_000612080.1.82156 WP_000612080.1.8218 WP_000612080.1.82180 WP_000612080.1.82201 WP_000612080.1.82214 WP_000612080.1.82225 WP_000612080.1.82269 WP_000612080.1.82347 WP_000612080.1.82352 WP_000612080.1.82395 WP_000612080.1.8240 WP_000612080.1.82401 WP_000612080.1.82408 WP_000612080.1.82416 WP_000612080.1.8242 WP_000612080.1.82420 WP_000612080.1.82434 WP_000612080.1.82456 WP_000612080.1.82465 WP_000612080.1.8247 WP_000612080.1.82473 WP_000612080.1.82474 WP_000612080.1.82553 WP_000612080.1.82562 WP_000612080.1.82569 WP_000612080.1.82637 WP_000612080.1.82646 WP_000612080.1.82670 WP_000612080.1.82731 WP_000612080.1.82763 WP_000612080.1.82812 WP_000612080.1.82850 WP_000612080.1.82867 WP_000612080.1.82872 WP_000612080.1.82886 WP_000612080.1.82895 WP_000612080.1.82899 WP_000612080.1.82908 WP_000612080.1.82937 WP_000612080.1.8294 WP_000612080.1.82946 WP_000612080.1.82959 WP_000612080.1.82964 WP_000612080.1.82992 WP_000612080.1.83005 WP_000612080.1.83006 WP_000612080.1.83007 WP_000612080.1.8304 WP_000612080.1.83061 WP_000612080.1.83119 WP_000612080.1.83139 WP_000612080.1.83180 WP_000612080.1.83204 WP_000612080.1.8322 WP_000612080.1.83229 WP_000612080.1.83235 WP_000612080.1.83247 WP_000612080.1.83258 WP_000612080.1.83290 WP_000612080.1.83331 WP_000612080.1.83333 WP_000612080.1.83354 WP_000612080.1.83356 WP_000612080.1.83378 WP_000612080.1.83388 WP_000612080.1.83510 WP_000612080.1.83516 WP_000612080.1.83558 WP_000612080.1.83598 WP_000612080.1.83651 WP_000612080.1.83657 WP_000612080.1.83677 WP_000612080.1.83739 WP_000612080.1.8375 WP_000612080.1.83759 WP_000612080.1.83897 WP_000612080.1.83923 WP_000612080.1.83960 WP_000612080.1.83979 WP_000612080.1.8399 WP_000612080.1.83994 WP_000612080.1.84 WP_000612080.1.84000 WP_000612080.1.84011 WP_000612080.1.84031 WP_000612080.1.8406 WP_000612080.1.84075 WP_000612080.1.84076 WP_000612080.1.84077 WP_000612080.1.84083 WP_000612080.1.84086 WP_000612080.1.84106 WP_000612080.1.84110 WP_000612080.1.84115 WP_000612080.1.84127 WP_000612080.1.84150 WP_000612080.1.84154 WP_000612080.1.84168 WP_000612080.1.84179 WP_000612080.1.84198 WP_000612080.1.84205 WP_000612080.1.84209 WP_000612080.1.84229 WP_000612080.1.84230 WP_000612080.1.8425 WP_000612080.1.84252 WP_000612080.1.84300 WP_000612080.1.8431 WP_000612080.1.84325 WP_000612080.1.84345 WP_000612080.1.84369 WP_000612080.1.84373 WP_000612080.1.84401 WP_000612080.1.84403 WP_000612080.1.84435 WP_000612080.1.84459 WP_000612080.1.84461 WP_000612080.1.84475 WP_000612080.1.84497 WP_000612080.1.84515 WP_000612080.1.84523 WP_000612080.1.84567 WP_000612080.1.84572 WP_000612080.1.84598 WP_000612080.1.84631 WP_000612080.1.84644 WP_000612080.1.84683 WP_000612080.1.84727 WP_000612080.1.84744 WP_000612080.1.84745 WP_000612080.1.84773 WP_000612080.1.84876 WP_000612080.1.849 WP_000612080.1.84945 WP_000612080.1.84967 WP_000612080.1.84983 WP_000612080.1.850 WP_000612080.1.85004 WP_000612080.1.8502 WP_000612080.1.85031 WP_000612080.1.85039 WP_000612080.1.85079 WP_000612080.1.85120 WP_000612080.1.85153 WP_000612080.1.85192 WP_000612080.1.85217 WP_000612080.1.8526 WP_000612080.1.85271 WP_000612080.1.85273 WP_000612080.1.85301 WP_000612080.1.85338 WP_000612080.1.85339 WP_000612080.1.8537 WP_000612080.1.85408 WP_000612080.1.85456 WP_000612080.1.85469 WP_000612080.1.85511 WP_000612080.1.85512 WP_000612080.1.8552 WP_000612080.1.8557 WP_000612080.1.85606 WP_000612080.1.85635 WP_000612080.1.85646 WP_000612080.1.85665 WP_000612080.1.85669 WP_000612080.1.85675 WP_000612080.1.85688 WP_000612080.1.85703 WP_000612080.1.85728 WP_000612080.1.85742 WP_000612080.1.85746 WP_000612080.1.85759 WP_000612080.1.85780 WP_000612080.1.85784 WP_000612080.1.85797 WP_000612080.1.85811 WP_000612080.1.85854 WP_000612080.1.85864 WP_000612080.1.859 WP_000612080.1.85917 WP_000612080.1.8594 WP_000612080.1.85977 WP_000612080.1.85982 WP_000612080.1.860 WP_000612080.1.86007 WP_000612080.1.8605 WP_000612080.1.86084 WP_000612080.1.86092 WP_000612080.1.8610 WP_000612080.1.86120 WP_000612080.1.86138 WP_000612080.1.8614 WP_000612080.1.86156 WP_000612080.1.86157 WP_000612080.1.86159 WP_000612080.1.8616 WP_000612080.1.86206 WP_000612080.1.86224 WP_000612080.1.86240 WP_000612080.1.86259 WP_000612080.1.86284 WP_000612080.1.86285 WP_000612080.1.86310 WP_000612080.1.86323 WP_000612080.1.86335 WP_000612080.1.86342 WP_000612080.1.86347 WP_000612080.1.86380 WP_000612080.1.86389 WP_000612080.1.8640 WP_000612080.1.8642 WP_000612080.1.86426 WP_000612080.1.86442 WP_000612080.1.8647 WP_000612080.1.86489 WP_000612080.1.86514 WP_000612080.1.86530 WP_000612080.1.86593 WP_000612080.1.86601 WP_000612080.1.86610 WP_000612080.1.86656 WP_000612080.1.86658 WP_000612080.1.86663 WP_000612080.1.86676 WP_000612080.1.86770 WP_000612080.1.86794 WP_000612080.1.86800 WP_000612080.1.86807 WP_000612080.1.86811 WP_000612080.1.86815 WP_000612080.1.86860 WP_000612080.1.8691 WP_000612080.1.86915 WP_000612080.1.86921 WP_000612080.1.86945 WP_000612080.1.86982 WP_000612080.1.86989 WP_000612080.1.87023 WP_000612080.1.87034 WP_000612080.1.87038 WP_000612080.1.87041 WP_000612080.1.87051 WP_000612080.1.87136 WP_000612080.1.87143 WP_000612080.1.87155 WP_000612080.1.87187 WP_000612080.1.87219 WP_000612080.1.87258 WP_000612080.1.87265 WP_000612080.1.87282 WP_000612080.1.87283 WP_000612080.1.87293 WP_000612080.1.87346 WP_000612080.1.87365 WP_000612080.1.87370 WP_000612080.1.87420 WP_000612080.1.87484 WP_000612080.1.87493 WP_000612080.1.87500 WP_000612080.1.87528 WP_000612080.1.87560 WP_000612080.1.87583 WP_000612080.1.8760 WP_000612080.1.87600 WP_000612080.1.87609 WP_000612080.1.87612 WP_000612080.1.87615 WP_000612080.1.87618 WP_000612080.1.87626 WP_000612080.1.87653 WP_000612080.1.87659 WP_000612080.1.87698 WP_000612080.1.87706 WP_000612080.1.87712 WP_000612080.1.87739 WP_000612080.1.87741 WP_000612080.1.87742 WP_000612080.1.87760 WP_000612080.1.87813 WP_000612080.1.87852 WP_000612080.1.87905 WP_000612080.1.87936 WP_000612080.1.87949 WP_000612080.1.87999 WP_000612080.1.8800 WP_000612080.1.88014 WP_000612080.1.88025 WP_000612080.1.88026 WP_000612080.1.8805 WP_000612080.1.88052 WP_000612080.1.8806 WP_000612080.1.881 WP_000612080.1.88136 WP_000612080.1.88145 WP_000612080.1.88165 WP_000612080.1.88174 WP_000612080.1.88185 WP_000612080.1.88199 WP_000612080.1.88214 WP_000612080.1.88222 WP_000612080.1.88244 WP_000612080.1.88264 WP_000612080.1.88275 WP_000612080.1.88299 WP_000612080.1.88303 WP_000612080.1.88313 WP_000612080.1.88356 WP_000612080.1.88359 WP_000612080.1.88407 WP_000612080.1.88414 WP_000612080.1.88423 WP_000612080.1.88444 WP_000612080.1.88446 WP_000612080.1.88458 WP_000612080.1.88474 WP_000612080.1.8849 WP_000612080.1.88501 WP_000612080.1.88508 WP_000612080.1.88538 WP_000612080.1.88547 WP_000612080.1.88597 WP_000612080.1.886 WP_000612080.1.88609 WP_000612080.1.88624 WP_000612080.1.88647 WP_000612080.1.88648 WP_000612080.1.88651 WP_000612080.1.88683 WP_000612080.1.88692 WP_000612080.1.88698 WP_000612080.1.88707 WP_000612080.1.88727 WP_000612080.1.88731 WP_000612080.1.88762 WP_000612080.1.88772 WP_000612080.1.88776 WP_000612080.1.88850 WP_000612080.1.88854 WP_000612080.1.8889 WP_000612080.1.88892 WP_000612080.1.88894 WP_000612080.1.88966 WP_000612080.1.88967 WP_000612080.1.88968 WP_000612080.1.88970 WP_000612080.1.88982 WP_000612080.1.88995 WP_000612080.1.88998 WP_000612080.1.89054 WP_000612080.1.89120 WP_000612080.1.89177 WP_000612080.1.89182 WP_000612080.1.89188 WP_000612080.1.89215 WP_000612080.1.89221 WP_000612080.1.89291 WP_000612080.1.89298 WP_000612080.1.89308 WP_000612080.1.89311 WP_000612080.1.89314 WP_000612080.1.89328 WP_000612080.1.89332 WP_000612080.1.89343 WP_000612080.1.89354 WP_000612080.1.89355 WP_000612080.1.89362 WP_000612080.1.89395 WP_000612080.1.8940 WP_000612080.1.89408 WP_000612080.1.89425 WP_000612080.1.89449 WP_000612080.1.89452 WP_000612080.1.8947 WP_000612080.1.89503 WP_000612080.1.89580 WP_000612080.1.89591 WP_000612080.1.89606 WP_000612080.1.8961 WP_000612080.1.89612 WP_000612080.1.89632 WP_000612080.1.89634 WP_000612080.1.89668 WP_000612080.1.89680 WP_000612080.1.89706 WP_000612080.1.89713 WP_000612080.1.89733 WP_000612080.1.89746 WP_000612080.1.89789 WP_000612080.1.89796 WP_000612080.1.89804 WP_000612080.1.89815 WP_000612080.1.89832 WP_000612080.1.89845 WP_000612080.1.89870 WP_000612080.1.89888 WP_000612080.1.89911 WP_000612080.1.89914 WP_000612080.1.89940 WP_000612080.1.8995 WP_000612080.1.89952 WP_000612080.1.89965 WP_000612080.1.89975 WP_000612080.1.90007 WP_000612080.1.9003 WP_000612080.1.90033 WP_000612080.1.9011 WP_000612080.1.90196 WP_000612080.1.90240 WP_000612080.1.90248 WP_000612080.1.90274 WP_000612080.1.90280 WP_000612080.1.90293 WP_000612080.1.90330 WP_000612080.1.90338 WP_000612080.1.90348 WP_000612080.1.90363 WP_000612080.1.90365 WP_000612080.1.90409 WP_000612080.1.90421 WP_000612080.1.90428 WP_000612080.1.90440 WP_000612080.1.90489 WP_000612080.1.90513 WP_000612080.1.90521 WP_000612080.1.90522 WP_000612080.1.90540 WP_000612080.1.90563 WP_000612080.1.90582 WP_000612080.1.90620 WP_000612080.1.90625 WP_000612080.1.9064 WP_000612080.1.90713 WP_000612080.1.90748 WP_000612080.1.90759 WP_000612080.1.90794 WP_000612080.1.90796 WP_000612080.1.90811 WP_000612080.1.90814 WP_000612080.1.90859 WP_000612080.1.90866 WP_000612080.1.9089 WP_000612080.1.9091 WP_000612080.1.9093 WP_000612080.1.90959 WP_000612080.1.90973 WP_000612080.1.90984 WP_000612080.1.90991 WP_000612080.1.91023 WP_000612080.1.91042 WP_000612080.1.91067 WP_000612080.1.91156 WP_000612080.1.91164 WP_000612080.1.91189 WP_000612080.1.91205 WP_000612080.1.91215 WP_000612080.1.91239 WP_000612080.1.91291 WP_000612080.1.91313 WP_000612080.1.91334 WP_000612080.1.9135 WP_000612080.1.9137 WP_000612080.1.91372 WP_000612080.1.91381 WP_000612080.1.91424 WP_000612080.1.91453 WP_000612080.1.91459 WP_000612080.1.91473 WP_000612080.1.91505 WP_000612080.1.91506 WP_000612080.1.91524 WP_000612080.1.91557 WP_000612080.1.91579 WP_000612080.1.91580 WP_000612080.1.91597 WP_000612080.1.91625 WP_000612080.1.91702 WP_000612080.1.91715 WP_000612080.1.91736 WP_000612080.1.91742 WP_000612080.1.91772 WP_000612080.1.91776 WP_000612080.1.91795 WP_000612080.1.91806 WP_000612080.1.91864 WP_000612080.1.9187 WP_000612080.1.91870 WP_000612080.1.91898 WP_000612080.1.91903 WP_000612080.1.91904 WP_000612080.1.91914 WP_000612080.1.91974 WP_000612080.1.92018 WP_000612080.1.92047 WP_000612080.1.92068 WP_000612080.1.92082 WP_000612080.1.92087 WP_000612080.1.92098 WP_000612080.1.92099 WP_000612080.1.92122 WP_000612080.1.92129 WP_000612080.1.92149 WP_000612080.1.92156 WP_000612080.1.92172 WP_000612080.1.92213 WP_000612080.1.9222 WP_000612080.1.92240 WP_000612080.1.92243 WP_000612080.1.92270 WP_000612080.1.92299 WP_000612080.1.92327 WP_000612080.1.92394 WP_000612080.1.92408 WP_000612080.1.92411 WP_000612080.1.92439 WP_000612080.1.92452 WP_000612080.1.92470 WP_000612080.1.92477 WP_000612080.1.92529 WP_000612080.1.92545 WP_000612080.1.92557 WP_000612080.1.92570 WP_000612080.1.92575 WP_000612080.1.92588 WP_000612080.1.926 WP_000612080.1.92628 WP_000612080.1.92633 WP_000612080.1.92649 WP_000612080.1.92676 WP_000612080.1.92705 WP_000612080.1.9271 WP_000612080.1.92734 WP_000612080.1.92754 WP_000612080.1.92806 WP_000612080.1.92810 WP_000612080.1.92823 WP_000612080.1.92827 WP_000612080.1.92832 WP_000612080.1.92836 WP_000612080.1.92843 WP_000612080.1.92875 WP_000612080.1.92879 WP_000612080.1.92883 WP_000612080.1.92890 WP_000612080.1.92895 WP_000612080.1.92929 WP_000612080.1.92939 WP_000612080.1.92987 WP_000612080.1.93007 WP_000612080.1.93022 WP_000612080.1.93076 WP_000612080.1.93103 WP_000612080.1.93105 WP_000612080.1.93111 WP_000612080.1.93121 WP_000612080.1.93168 WP_000612080.1.93184 WP_000612080.1.93213 WP_000612080.1.93215 WP_000612080.1.93221 WP_000612080.1.93223 WP_000612080.1.93239 WP_000612080.1.93302 WP_000612080.1.93350 WP_000612080.1.9336 WP_000612080.1.93387 WP_000612080.1.93410 WP_000612080.1.93469 WP_000612080.1.93511 WP_000612080.1.93512 WP_000612080.1.93524 WP_000612080.1.93577 WP_000612080.1.93596 WP_000612080.1.93635 WP_000612080.1.93648 WP_000612080.1.93657 WP_000612080.1.93671 WP_000612080.1.93691 WP_000612080.1.9374 WP_000612080.1.93741 WP_000612080.1.9375 WP_000612080.1.93754 WP_000612080.1.93761 WP_000612080.1.93767 WP_000612080.1.93780 WP_000612080.1.9380 WP_000612080.1.93803 WP_000612080.1.93809 WP_000612080.1.93828 WP_000612080.1.93842 WP_000612080.1.93843 WP_000612080.1.93875 WP_000612080.1.93909 WP_000612080.1.93919 WP_000612080.1.93938 WP_000612080.1.93984 WP_000612080.1.9399 WP_000612080.1.94017 WP_000612080.1.94039 WP_000612080.1.94056 WP_000612080.1.94064 WP_000612080.1.94079 WP_000612080.1.94097 WP_000612080.1.94107 WP_000612080.1.94132 WP_000612080.1.94142 WP_000612080.1.94215 WP_000612080.1.94303 WP_000612080.1.94352 WP_000612080.1.94365 WP_000612080.1.94390 WP_000612080.1.9440 WP_000612080.1.94415 WP_000612080.1.94473 WP_000612080.1.94492 WP_000612080.1.94510 WP_000612080.1.94527 WP_000612080.1.94573 WP_000612080.1.94579 WP_000612080.1.94586 WP_000612080.1.94593 WP_000612080.1.94598 WP_000612080.1.94622 WP_000612080.1.9463 WP_000612080.1.94649 WP_000612080.1.94650 WP_000612080.1.94659 WP_000612080.1.94662 WP_000612080.1.94670 WP_000612080.1.94700 WP_000612080.1.94717 WP_000612080.1.94745 WP_000612080.1.94782 WP_000612080.1.94798 WP_000612080.1.9481 WP_000612080.1.94815 WP_000612080.1.94820 WP_000612080.1.94835 WP_000612080.1.94849 WP_000612080.1.94850 WP_000612080.1.94851 WP_000612080.1.94862 WP_000612080.1.94864 WP_000612080.1.94947 WP_000612080.1.94952 WP_000612080.1.94971 WP_000612080.1.94982 WP_000612080.1.94983 WP_000612080.1.94986 WP_000612080.1.95006 WP_000612080.1.9503 WP_000612080.1.95055 WP_000612080.1.95076 WP_000612080.1.95099 WP_000612080.1.95136 WP_000612080.1.95152 WP_000612080.1.9516 WP_000612080.1.95165 WP_000612080.1.95171 WP_000612080.1.95235 WP_000612080.1.95239 WP_000612080.1.95246 WP_000612080.1.95249 WP_000612080.1.9525 WP_000612080.1.95255 WP_000612080.1.95265 WP_000612080.1.9527 WP_000612080.1.95289 WP_000612080.1.95298 WP_000612080.1.9530 WP_000612080.1.95320 WP_000612080.1.95338 WP_000612080.1.95404 WP_000612080.1.95412 WP_000612080.1.95434 WP_000612080.1.95447 WP_000612080.1.95456 WP_000612080.1.95465 WP_000612080.1.95530 WP_000612080.1.95547 WP_000612080.1.95558 WP_000612080.1.95579 WP_000612080.1.95590 WP_000612080.1.95607 WP_000612080.1.95623 WP_000612080.1.95625 WP_000612080.1.95641 WP_000612080.1.95656 WP_000612080.1.95675 WP_000612080.1.95701 WP_000612080.1.95703 WP_000612080.1.95716 WP_000612080.1.95729 WP_000612080.1.9574 WP_000612080.1.95757 WP_000612080.1.95776 WP_000612080.1.95803 WP_000612080.1.95826 WP_000612080.1.95840 WP_000612080.1.9586 WP_000612080.1.95866 WP_000612080.1.95884 WP_000612080.1.95890 WP_000612080.1.95901 WP_000612080.1.95906 WP_000612080.1.95940 WP_000612080.1.95963 WP_000612080.1.96025 WP_000612080.1.96042 WP_000612080.1.96044 WP_000612080.1.96054 WP_000612080.1.9609 WP_000612080.1.96094 WP_000612080.1.96107 WP_000612080.1.96127 WP_000612080.1.96144 WP_000612080.1.96172 WP_000612080.1.96188 WP_000612080.1.96190 WP_000612080.1.96203 WP_000612080.1.96211 WP_000612080.1.96212 WP_000612080.1.9624 WP_000612080.1.96260 WP_000612080.1.9627 WP_000612080.1.96319 WP_000612080.1.9633 WP_000612080.1.96340 WP_000612080.1.96348 WP_000612080.1.96349 WP_000612080.1.96359 WP_000612080.1.96380 WP_000612080.1.96404 WP_000612080.1.96429 WP_000612080.1.96490 WP_000612080.1.96521 WP_000612080.1.96537 WP_000612080.1.96539 WP_000612080.1.96552 WP_000612080.1.96584 WP_000612080.1.96588 WP_000612080.1.96610 WP_000612080.1.96625 WP_000612080.1.96635 WP_000612080.1.9664 WP_000612080.1.96642 WP_000612080.1.96662 WP_000612080.1.96675 WP_000612080.1.9670 WP_000612080.1.96735 WP_000612080.1.96750 WP_000612080.1.96792 WP_000612080.1.96798 WP_000612080.1.96801 WP_000612080.1.96803 WP_000612080.1.96810 WP_000612080.1.9686 WP_000612080.1.96876 WP_000612080.1.96890 WP_000612080.1.96925 WP_000612080.1.96938 WP_000612080.1.96946 WP_000612080.1.96957 WP_000612080.1.96978 WP_000612080.1.96993 WP_000612080.1.97005 WP_000612080.1.97026 WP_000612080.1.97028 WP_000612080.1.97043 WP_000612080.1.97079 WP_000612080.1.97089 WP_000612080.1.97103 WP_000612080.1.97109 WP_000612080.1.97154 WP_000612080.1.97184 WP_000612080.1.97185 WP_000612080.1.97260 WP_000612080.1.97287 WP_000612080.1.97291 WP_000612080.1.97322 WP_000612080.1.97328 WP_000612080.1.97337 WP_000612080.1.97368 WP_000612080.1.97386 WP_000612080.1.97413 WP_000612080.1.97422 WP_000612080.1.97441 WP_000612080.1.97480 WP_000612080.1.97496 WP_000612080.1.97497 WP_000612080.1.97505 WP_000612080.1.97534 WP_000612080.1.97547 WP_000612080.1.97599 WP_000612080.1.97606 WP_000612080.1.97615 WP_000612080.1.97626 WP_000612080.1.97640 WP_000612080.1.97646 WP_000612080.1.97648 WP_000612080.1.97656 WP_000612080.1.97690 WP_000612080.1.97691 WP_000612080.1.97704 WP_000612080.1.97725 WP_000612080.1.97726 WP_000612080.1.9774 WP_000612080.1.97772 WP_000612080.1.97819 WP_000612080.1.97840 WP_000612080.1.97873 WP_000612080.1.9793 WP_000612080.1.97938 WP_000612080.1.97981 WP_000612080.1.97986 WP_000612080.1.97991 WP_000612080.1.98036 WP_000612080.1.98080 WP_000612080.1.98086 WP_000612080.1.98107 WP_000612080.1.98119 WP_000612080.1.98124 WP_000612080.1.98158 WP_000612080.1.98201 WP_000612080.1.98236 WP_000612080.1.98263 WP_000612080.1.98338 WP_000612080.1.98392 WP_000612080.1.98403 WP_000612080.1.98418 WP_000612080.1.98438 WP_000612080.1.98440 WP_000612080.1.98448 WP_000612080.1.98457 WP_000612080.1.98472 WP_000612080.1.98483 WP_000612080.1.9850 WP_000612080.1.98502 WP_000612080.1.98513 WP_000612080.1.98551 WP_000612080.1.98570 WP_000612080.1.98607 WP_000612080.1.98627 WP_000612080.1.9863 WP_000612080.1.98726 WP_000612080.1.98731 WP_000612080.1.98751 WP_000612080.1.98762 WP_000612080.1.98763 WP_000612080.1.9877 WP_000612080.1.98801 WP_000612080.1.98818 WP_000612080.1.9887 WP_000612080.1.98931 WP_000612080.1.98947 WP_000612080.1.9899 WP_000612080.1.99040 WP_000612080.1.99057 WP_000612080.1.99071 WP_000612080.1.99072 WP_000612080.1.99083 WP_000612080.1.99097 WP_000612080.1.99107 WP_000612080.1.99163 WP_000612080.1.99164 WP_000612080.1.9919 WP_000612080.1.99197 WP_000612080.1.99215 WP_000612080.1.99278 WP_000612080.1.99335 WP_000612080.1.99339 WP_000612080.1.99350 WP_000612080.1.99360 WP_000612080.1.99363 WP_000612080.1.99369 WP_000612080.1.99370 WP_000612080.1.99388 WP_000612080.1.99397 WP_000612080.1.99456 WP_000612080.1.99463 WP_000612080.1.99483 WP_000612080.1.99490 WP_000612080.1.99493 WP_000612080.1.9954 WP_000612080.1.99546 WP_000612080.1.99561 WP_000612080.1.99577 WP_000612080.1.99579 WP_000612080.1.99595 WP_000612080.1.99613 WP_000612080.1.99630 WP_000612080.1.99637 WP_000612080.1.99671 WP_000612080.1.99676 WP_000612080.1.99725 WP_000612080.1.99747 WP_000612080.1.99764 WP_000612080.1.99829 WP_000612080.1.99837 WP_000612080.1.99841 WP_000612080.1.9992 WP_000612080.1.99924 WP_000612080.1.99961 WP_000612080.1.99996 gi|16762205|ref|NP_457822.1| gi|161617042|ref|YP_001591007.1| gi|528821505|ref|YP_008362708.1| gi|488655824|ref|YP_007927627.1| gi|378961545|ref|YP_005219031.1| gi|198243997|ref|YP_002217862.1| gi|194444532|ref|YP_002043162.1| gi|29143694|ref|NP_807036.1| 209261.t3372 220341.STY3630 272994.SPAB_04870 423368.SNSL254_A4205 439843.SeSA_A4136 439851.SeD_A4313 454166.SeAg_B4151 476213.SPC_4039 550537.SEN3730 gi|194737693|ref|YP_002116860.1| gi|549481160|ref|YP_008615546.1| ABAN01000031|CDS_7301-6171 ABEJ01000018|CDS_31306-32436 ABEW01000013|CDS_60485-59355 ABFF01000029|CDS_28469-29599 ABFG01000008|CDS_220586-219456 AE014613|CDS_3472967-3471837 AL513382|CDS_3487309-3486179 AM933172|CDS_4004053-4005183 CP000857|CDS_4108820-4109950 CP000886|CDS_4079109-4080239 CP001113|CDS_4099973-4101103 CP001127|CDS_4012980-4014110 CP001138|CDS_4053410-4054540 CP001144|CDS_4162274-4163404 gi|207859135|ref|YP_002245786.1| gi|224585748|ref|YP_002639547.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]