SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16762332|ref|NP_457949.1| from Salmonella enterica subsp. enterica serovar Typhi str. CT18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16762332|ref|NP_457949.1|
Domain Number 1 Region: 13-418
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.3e-172
Family GABA-aminotransferase-like 0.00000000201
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16762332|ref|NP_457949.1|
Sequence length 419
Comment serine hydroxymethyltransferase [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
Sequence
MNFRGNRMINNDPLFDLLNKEQQRQQHSLELIASENFASPAVLAAQGSVLTNKYAEGYYQ
HRYYGGCKFIDEVEMLAITRAQQLFGARYVNVQPHSGSQANQAVYLALLKPGDKILGMSL
QCGGHLTHGSPVNQSGKWFNAFHYGVDAHSGLIDMDEVETIAKRERPRLIIAGGSAYPRH
YDFARFRRIADAVGAMLLVDMAHFAGLVAGGCFPSPLAYADVITATTHKTLRGPRGGMIL
TNDARLAKKIDSAIFPGLQGGPLMHVIAAKAVALGEALQPEFKRYAGQVIENAQAMCQQL
AQRGLTLLTGGTDCHLGIIDLRPQGLTGAQVEYFLELAGITVNKNTLLGDPQPPSITSGI
RIGSAACATRGMKADDFTLIADWISEIIFAIKTPNIADICADIRQKVTKLTTNYPLPYQ
Download sequence
Identical sequences Q8Z2Z9
NP_457949.1.84458 WP_010989256.1.100008 WP_010989256.1.100036 WP_010989256.1.100079 WP_010989256.1.100196 WP_010989256.1.100284 WP_010989256.1.100313 WP_010989256.1.100314 WP_010989256.1.100321 WP_010989256.1.100354 WP_010989256.1.100421 WP_010989256.1.100446 WP_010989256.1.100450 WP_010989256.1.100592 WP_010989256.1.100610 WP_010989256.1.100732 WP_010989256.1.100733 WP_010989256.1.100739 WP_010989256.1.100764 WP_010989256.1.100799 WP_010989256.1.100941 WP_010989256.1.100953 WP_010989256.1.101011 WP_010989256.1.10108 WP_010989256.1.101226 WP_010989256.1.10124 WP_010989256.1.101271 WP_010989256.1.101312 WP_010989256.1.101322 WP_010989256.1.101374 WP_010989256.1.101616 WP_010989256.1.101890 WP_010989256.1.101941 WP_010989256.1.102050 WP_010989256.1.102087 WP_010989256.1.10338 WP_010989256.1.1038 WP_010989256.1.104 WP_010989256.1.10401 WP_010989256.1.10428 WP_010989256.1.10459 WP_010989256.1.10475 WP_010989256.1.10511 WP_010989256.1.10514 WP_010989256.1.10530 WP_010989256.1.10532 WP_010989256.1.10547 WP_010989256.1.10595 WP_010989256.1.10642 WP_010989256.1.10654 WP_010989256.1.10677 WP_010989256.1.10857 WP_010989256.1.10873 WP_010989256.1.10926 WP_010989256.1.10936 WP_010989256.1.11012 WP_010989256.1.11055 WP_010989256.1.11126 WP_010989256.1.11142 WP_010989256.1.11239 WP_010989256.1.11253 WP_010989256.1.11314 WP_010989256.1.11385 WP_010989256.1.1142 WP_010989256.1.11426 WP_010989256.1.11429 WP_010989256.1.11557 WP_010989256.1.11567 WP_010989256.1.11638 WP_010989256.1.11883 WP_010989256.1.11908 WP_010989256.1.11914 WP_010989256.1.12040 WP_010989256.1.12061 WP_010989256.1.1207 WP_010989256.1.12141 WP_010989256.1.12172 WP_010989256.1.12192 WP_010989256.1.1224 WP_010989256.1.12364 WP_010989256.1.12398 WP_010989256.1.12441 WP_010989256.1.12581 WP_010989256.1.12620 WP_010989256.1.12648 WP_010989256.1.12683 WP_010989256.1.12726 WP_010989256.1.12727 WP_010989256.1.12741 WP_010989256.1.12834 WP_010989256.1.13108 WP_010989256.1.13161 WP_010989256.1.1321 WP_010989256.1.13268 WP_010989256.1.13291 WP_010989256.1.133 WP_010989256.1.13314 WP_010989256.1.13338 WP_010989256.1.13342 WP_010989256.1.13352 WP_010989256.1.13406 WP_010989256.1.13440 WP_010989256.1.13443 WP_010989256.1.13476 WP_010989256.1.13599 WP_010989256.1.13686 WP_010989256.1.1372 WP_010989256.1.13732 WP_010989256.1.1382 WP_010989256.1.1397 WP_010989256.1.13972 WP_010989256.1.140 WP_010989256.1.1401 WP_010989256.1.1408 WP_010989256.1.14089 WP_010989256.1.14099 WP_010989256.1.14120 WP_010989256.1.14123 WP_010989256.1.14150 WP_010989256.1.14191 WP_010989256.1.14197 WP_010989256.1.14280 WP_010989256.1.14333 WP_010989256.1.14444 WP_010989256.1.14467 WP_010989256.1.14474 WP_010989256.1.14500 WP_010989256.1.14526 WP_010989256.1.14550 WP_010989256.1.14575 WP_010989256.1.14701 WP_010989256.1.14703 WP_010989256.1.14719 WP_010989256.1.1473 WP_010989256.1.14765 WP_010989256.1.14810 WP_010989256.1.14877 WP_010989256.1.14894 WP_010989256.1.14930 WP_010989256.1.14947 WP_010989256.1.14948 WP_010989256.1.15184 WP_010989256.1.15244 WP_010989256.1.15265 WP_010989256.1.15362 WP_010989256.1.15415 WP_010989256.1.15423 WP_010989256.1.15433 WP_010989256.1.15439 WP_010989256.1.15487 WP_010989256.1.15535 WP_010989256.1.15581 WP_010989256.1.15597 WP_010989256.1.15710 WP_010989256.1.15717 WP_010989256.1.15905 WP_010989256.1.15912 WP_010989256.1.15970 WP_010989256.1.16046 WP_010989256.1.16051 WP_010989256.1.16058 WP_010989256.1.16150 WP_010989256.1.16155 WP_010989256.1.1626 WP_010989256.1.16264 WP_010989256.1.16344 WP_010989256.1.16452 WP_010989256.1.16461 WP_010989256.1.16462 WP_010989256.1.16465 WP_010989256.1.16522 WP_010989256.1.16588 WP_010989256.1.16658 WP_010989256.1.16666 WP_010989256.1.16673 WP_010989256.1.1674 WP_010989256.1.16767 WP_010989256.1.16781 WP_010989256.1.16879 WP_010989256.1.16893 WP_010989256.1.16905 WP_010989256.1.16948 WP_010989256.1.17049 WP_010989256.1.17058 WP_010989256.1.17078 WP_010989256.1.17202 WP_010989256.1.17219 WP_010989256.1.1722 WP_010989256.1.17302 WP_010989256.1.17308 WP_010989256.1.17368 WP_010989256.1.17405 WP_010989256.1.17406 WP_010989256.1.17513 WP_010989256.1.17543 WP_010989256.1.17563 WP_010989256.1.17578 WP_010989256.1.17622 WP_010989256.1.17659 WP_010989256.1.17667 WP_010989256.1.17686 WP_010989256.1.17741 WP_010989256.1.17840 WP_010989256.1.17956 WP_010989256.1.18005 WP_010989256.1.1801 WP_010989256.1.18021 WP_010989256.1.18099 WP_010989256.1.18124 WP_010989256.1.18144 WP_010989256.1.18173 WP_010989256.1.18270 WP_010989256.1.18280 WP_010989256.1.18328 WP_010989256.1.18358 WP_010989256.1.18370 WP_010989256.1.18406 WP_010989256.1.18474 WP_010989256.1.18513 WP_010989256.1.18610 WP_010989256.1.18678 WP_010989256.1.18722 WP_010989256.1.18766 WP_010989256.1.1880 WP_010989256.1.1885 WP_010989256.1.18860 WP_010989256.1.18922 WP_010989256.1.18959 WP_010989256.1.19001 WP_010989256.1.19006 WP_010989256.1.19044 WP_010989256.1.19084 WP_010989256.1.19187 WP_010989256.1.19228 WP_010989256.1.19288 WP_010989256.1.19300 WP_010989256.1.19422 WP_010989256.1.19456 WP_010989256.1.19496 WP_010989256.1.19535 WP_010989256.1.19538 WP_010989256.1.19589 WP_010989256.1.19663 WP_010989256.1.19686 WP_010989256.1.19731 WP_010989256.1.19794 WP_010989256.1.1992 WP_010989256.1.19999 WP_010989256.1.20254 WP_010989256.1.20255 WP_010989256.1.20296 WP_010989256.1.20339 WP_010989256.1.20419 WP_010989256.1.20465 WP_010989256.1.20492 WP_010989256.1.2053 WP_010989256.1.20635 WP_010989256.1.20718 WP_010989256.1.2073 WP_010989256.1.20740 WP_010989256.1.20828 WP_010989256.1.2087 WP_010989256.1.20883 WP_010989256.1.20947 WP_010989256.1.20953 WP_010989256.1.21010 WP_010989256.1.2106 WP_010989256.1.21062 WP_010989256.1.21144 WP_010989256.1.21162 WP_010989256.1.21184 WP_010989256.1.21185 WP_010989256.1.21366 WP_010989256.1.21492 WP_010989256.1.2166 WP_010989256.1.21674 WP_010989256.1.21946 WP_010989256.1.21966 WP_010989256.1.22064 WP_010989256.1.22118 WP_010989256.1.22126 WP_010989256.1.2216 WP_010989256.1.22208 WP_010989256.1.2227 WP_010989256.1.22373 WP_010989256.1.22476 WP_010989256.1.22614 WP_010989256.1.22652 WP_010989256.1.22683 WP_010989256.1.2284 WP_010989256.1.22895 WP_010989256.1.22926 WP_010989256.1.22943 WP_010989256.1.22967 WP_010989256.1.23040 WP_010989256.1.23058 WP_010989256.1.23218 WP_010989256.1.2331 WP_010989256.1.2332 WP_010989256.1.23340 WP_010989256.1.2336 WP_010989256.1.23365 WP_010989256.1.23412 WP_010989256.1.23426 WP_010989256.1.23492 WP_010989256.1.23515 WP_010989256.1.23548 WP_010989256.1.23571 WP_010989256.1.23604 WP_010989256.1.23679 WP_010989256.1.23728 WP_010989256.1.2375 WP_010989256.1.23783 WP_010989256.1.23786 WP_010989256.1.23787 WP_010989256.1.23801 WP_010989256.1.24028 WP_010989256.1.24061 WP_010989256.1.24083 WP_010989256.1.24117 WP_010989256.1.24125 WP_010989256.1.24138 WP_010989256.1.24153 WP_010989256.1.24291 WP_010989256.1.24322 WP_010989256.1.24375 WP_010989256.1.24400 WP_010989256.1.24619 WP_010989256.1.24643 WP_010989256.1.24688 WP_010989256.1.24716 WP_010989256.1.2481 WP_010989256.1.24832 WP_010989256.1.24964 WP_010989256.1.25017 WP_010989256.1.25032 WP_010989256.1.25041 WP_010989256.1.25053 WP_010989256.1.25140 WP_010989256.1.25185 WP_010989256.1.25196 WP_010989256.1.25210 WP_010989256.1.25219 WP_010989256.1.25304 WP_010989256.1.25374 WP_010989256.1.25475 WP_010989256.1.25490 WP_010989256.1.25508 WP_010989256.1.25512 WP_010989256.1.25603 WP_010989256.1.2562 WP_010989256.1.25666 WP_010989256.1.25807 WP_010989256.1.25821 WP_010989256.1.25833 WP_010989256.1.25835 WP_010989256.1.25882 WP_010989256.1.25911 WP_010989256.1.25962 WP_010989256.1.25963 WP_010989256.1.26001 WP_010989256.1.26027 WP_010989256.1.26107 WP_010989256.1.2615 WP_010989256.1.26217 WP_010989256.1.26230 WP_010989256.1.26232 WP_010989256.1.26272 WP_010989256.1.26286 WP_010989256.1.26288 WP_010989256.1.26394 WP_010989256.1.26491 WP_010989256.1.2654 WP_010989256.1.26554 WP_010989256.1.26636 WP_010989256.1.26689 WP_010989256.1.2679 WP_010989256.1.26908 WP_010989256.1.2692 WP_010989256.1.26928 WP_010989256.1.270 WP_010989256.1.27008 WP_010989256.1.27027 WP_010989256.1.27070 WP_010989256.1.27077 WP_010989256.1.27086 WP_010989256.1.27087 WP_010989256.1.27111 WP_010989256.1.27115 WP_010989256.1.2713 WP_010989256.1.2717 WP_010989256.1.27228 WP_010989256.1.27282 WP_010989256.1.27285 WP_010989256.1.27309 WP_010989256.1.27329 WP_010989256.1.27361 WP_010989256.1.27565 WP_010989256.1.27595 WP_010989256.1.27598 WP_010989256.1.27706 WP_010989256.1.27775 WP_010989256.1.27785 WP_010989256.1.27900 WP_010989256.1.27928 WP_010989256.1.27945 WP_010989256.1.28004 WP_010989256.1.2809 WP_010989256.1.28155 WP_010989256.1.28198 WP_010989256.1.2822 WP_010989256.1.28229 WP_010989256.1.28384 WP_010989256.1.28386 WP_010989256.1.28395 WP_010989256.1.284 WP_010989256.1.2845 WP_010989256.1.28479 WP_010989256.1.28627 WP_010989256.1.28692 WP_010989256.1.2873 WP_010989256.1.28917 WP_010989256.1.28962 WP_010989256.1.29023 WP_010989256.1.2905 WP_010989256.1.2907 WP_010989256.1.29081 WP_010989256.1.29089 WP_010989256.1.29153 WP_010989256.1.29203 WP_010989256.1.29237 WP_010989256.1.29248 WP_010989256.1.29288 WP_010989256.1.29389 WP_010989256.1.29439 WP_010989256.1.2946 WP_010989256.1.29462 WP_010989256.1.29563 WP_010989256.1.29727 WP_010989256.1.29743 WP_010989256.1.29782 WP_010989256.1.29833 WP_010989256.1.29851 WP_010989256.1.29865 WP_010989256.1.29886 WP_010989256.1.29919 WP_010989256.1.2994 WP_010989256.1.29964 WP_010989256.1.29983 WP_010989256.1.30009 WP_010989256.1.30013 WP_010989256.1.3002 WP_010989256.1.30034 WP_010989256.1.30049 WP_010989256.1.30058 WP_010989256.1.30172 WP_010989256.1.30185 WP_010989256.1.30354 WP_010989256.1.30357 WP_010989256.1.30362 WP_010989256.1.3042 WP_010989256.1.30421 WP_010989256.1.30440 WP_010989256.1.30448 WP_010989256.1.30489 WP_010989256.1.30517 WP_010989256.1.30542 WP_010989256.1.30544 WP_010989256.1.30556 WP_010989256.1.30572 WP_010989256.1.30585 WP_010989256.1.30618 WP_010989256.1.30664 WP_010989256.1.30688 WP_010989256.1.30806 WP_010989256.1.30967 WP_010989256.1.31046 WP_010989256.1.31066 WP_010989256.1.31078 WP_010989256.1.31139 WP_010989256.1.31145 WP_010989256.1.31182 WP_010989256.1.31205 WP_010989256.1.3121 WP_010989256.1.31223 WP_010989256.1.31303 WP_010989256.1.3131 WP_010989256.1.31352 WP_010989256.1.31389 WP_010989256.1.31413 WP_010989256.1.31446 WP_010989256.1.31533 WP_010989256.1.31799 WP_010989256.1.31836 WP_010989256.1.31951 WP_010989256.1.32041 WP_010989256.1.32042 WP_010989256.1.3207 WP_010989256.1.32189 WP_010989256.1.32202 WP_010989256.1.32263 WP_010989256.1.32293 WP_010989256.1.32299 WP_010989256.1.32422 WP_010989256.1.32425 WP_010989256.1.32458 WP_010989256.1.32460 WP_010989256.1.32529 WP_010989256.1.32563 WP_010989256.1.32578 WP_010989256.1.32617 WP_010989256.1.3270 WP_010989256.1.32725 WP_010989256.1.32838 WP_010989256.1.32848 WP_010989256.1.32868 WP_010989256.1.3290 WP_010989256.1.32940 WP_010989256.1.3296 WP_010989256.1.32966 WP_010989256.1.32985 WP_010989256.1.33037 WP_010989256.1.3305 WP_010989256.1.33051 WP_010989256.1.33065 WP_010989256.1.33122 WP_010989256.1.3315 WP_010989256.1.33208 WP_010989256.1.33214 WP_010989256.1.33247 WP_010989256.1.33280 WP_010989256.1.33283 WP_010989256.1.33313 WP_010989256.1.33339 WP_010989256.1.33382 WP_010989256.1.33490 WP_010989256.1.33501 WP_010989256.1.33529 WP_010989256.1.33689 WP_010989256.1.3370 WP_010989256.1.33730 WP_010989256.1.33741 WP_010989256.1.33840 WP_010989256.1.3392 WP_010989256.1.33926 WP_010989256.1.33957 WP_010989256.1.33969 WP_010989256.1.34001 WP_010989256.1.34059 WP_010989256.1.34118 WP_010989256.1.34211 WP_010989256.1.34214 WP_010989256.1.34234 WP_010989256.1.34284 WP_010989256.1.34376 WP_010989256.1.34382 WP_010989256.1.34484 WP_010989256.1.34517 WP_010989256.1.34530 WP_010989256.1.34665 WP_010989256.1.34694 WP_010989256.1.34751 WP_010989256.1.34808 WP_010989256.1.34824 WP_010989256.1.34834 WP_010989256.1.34932 WP_010989256.1.34962 WP_010989256.1.35001 WP_010989256.1.35040 WP_010989256.1.35074 WP_010989256.1.35175 WP_010989256.1.35240 WP_010989256.1.35274 WP_010989256.1.35532 WP_010989256.1.35560 WP_010989256.1.3557 WP_010989256.1.35628 WP_010989256.1.3570 WP_010989256.1.35712 WP_010989256.1.35713 WP_010989256.1.35736 WP_010989256.1.35791 WP_010989256.1.35795 WP_010989256.1.35870 WP_010989256.1.35916 WP_010989256.1.35938 WP_010989256.1.35966 WP_010989256.1.36000 WP_010989256.1.36034 WP_010989256.1.36036 WP_010989256.1.36069 WP_010989256.1.36291 WP_010989256.1.36298 WP_010989256.1.36308 WP_010989256.1.36323 WP_010989256.1.36343 WP_010989256.1.36460 WP_010989256.1.3649 WP_010989256.1.36495 WP_010989256.1.36526 WP_010989256.1.36567 WP_010989256.1.36579 WP_010989256.1.36617 WP_010989256.1.36618 WP_010989256.1.36643 WP_010989256.1.36663 WP_010989256.1.36701 WP_010989256.1.36725 WP_010989256.1.36779 WP_010989256.1.36798 WP_010989256.1.36802 WP_010989256.1.36821 WP_010989256.1.36853 WP_010989256.1.36950 WP_010989256.1.37014 WP_010989256.1.37133 WP_010989256.1.37176 WP_010989256.1.37199 WP_010989256.1.37200 WP_010989256.1.37258 WP_010989256.1.37303 WP_010989256.1.37513 WP_010989256.1.37584 WP_010989256.1.37590 WP_010989256.1.37593 WP_010989256.1.37600 WP_010989256.1.37613 WP_010989256.1.37659 WP_010989256.1.37662 WP_010989256.1.37675 WP_010989256.1.37691 WP_010989256.1.37761 WP_010989256.1.37775 WP_010989256.1.37777 WP_010989256.1.378 WP_010989256.1.379 WP_010989256.1.37911 WP_010989256.1.37941 WP_010989256.1.37985 WP_010989256.1.38061 WP_010989256.1.38064 WP_010989256.1.38108 WP_010989256.1.3816 WP_010989256.1.38207 WP_010989256.1.38261 WP_010989256.1.38266 WP_010989256.1.38310 WP_010989256.1.3834 WP_010989256.1.38351 WP_010989256.1.3838 WP_010989256.1.38381 WP_010989256.1.38440 WP_010989256.1.38486 WP_010989256.1.38595 WP_010989256.1.3860 WP_010989256.1.38642 WP_010989256.1.38734 WP_010989256.1.38877 WP_010989256.1.38983 WP_010989256.1.38996 WP_010989256.1.39056 WP_010989256.1.3907 WP_010989256.1.39105 WP_010989256.1.3914 WP_010989256.1.39147 WP_010989256.1.39161 WP_010989256.1.39210 WP_010989256.1.39235 WP_010989256.1.3931 WP_010989256.1.39435 WP_010989256.1.39502 WP_010989256.1.39530 WP_010989256.1.39619 WP_010989256.1.39620 WP_010989256.1.39624 WP_010989256.1.39659 WP_010989256.1.39667 WP_010989256.1.39775 WP_010989256.1.39879 WP_010989256.1.39890 WP_010989256.1.39941 WP_010989256.1.39945 WP_010989256.1.40095 WP_010989256.1.40097 WP_010989256.1.401 WP_010989256.1.40160 WP_010989256.1.40279 WP_010989256.1.40361 WP_010989256.1.4042 WP_010989256.1.40467 WP_010989256.1.40496 WP_010989256.1.40517 WP_010989256.1.40698 WP_010989256.1.40750 WP_010989256.1.40763 WP_010989256.1.40854 WP_010989256.1.4089 WP_010989256.1.40924 WP_010989256.1.40932 WP_010989256.1.40946 WP_010989256.1.41004 WP_010989256.1.4106 WP_010989256.1.41070 WP_010989256.1.41074 WP_010989256.1.41075 WP_010989256.1.41097 WP_010989256.1.41132 WP_010989256.1.41176 WP_010989256.1.41251 WP_010989256.1.41258 WP_010989256.1.41305 WP_010989256.1.41321 WP_010989256.1.41333 WP_010989256.1.41335 WP_010989256.1.4136 WP_010989256.1.41415 WP_010989256.1.41459 WP_010989256.1.41498 WP_010989256.1.41519 WP_010989256.1.41524 WP_010989256.1.41631 WP_010989256.1.41658 WP_010989256.1.41659 WP_010989256.1.41716 WP_010989256.1.41746 WP_010989256.1.41824 WP_010989256.1.41825 WP_010989256.1.41836 WP_010989256.1.41894 WP_010989256.1.41919 WP_010989256.1.41929 WP_010989256.1.4194 WP_010989256.1.42069 WP_010989256.1.42081 WP_010989256.1.42090 WP_010989256.1.42111 WP_010989256.1.42187 WP_010989256.1.42200 WP_010989256.1.42219 WP_010989256.1.42257 WP_010989256.1.42261 WP_010989256.1.42349 WP_010989256.1.42364 WP_010989256.1.42371 WP_010989256.1.42379 WP_010989256.1.42391 WP_010989256.1.42399 WP_010989256.1.42539 WP_010989256.1.42603 WP_010989256.1.42650 WP_010989256.1.4267 WP_010989256.1.42701 WP_010989256.1.42805 WP_010989256.1.42815 WP_010989256.1.42859 WP_010989256.1.4298 WP_010989256.1.43008 WP_010989256.1.43016 WP_010989256.1.43019 WP_010989256.1.43065 WP_010989256.1.43068 WP_010989256.1.43069 WP_010989256.1.43128 WP_010989256.1.43141 WP_010989256.1.43157 WP_010989256.1.43161 WP_010989256.1.43190 WP_010989256.1.43198 WP_010989256.1.4326 WP_010989256.1.43290 WP_010989256.1.43292 WP_010989256.1.43307 WP_010989256.1.43513 WP_010989256.1.43633 WP_010989256.1.43637 WP_010989256.1.43651 WP_010989256.1.43722 WP_010989256.1.43801 WP_010989256.1.43812 WP_010989256.1.43878 WP_010989256.1.43888 WP_010989256.1.43919 WP_010989256.1.43974 WP_010989256.1.44049 WP_010989256.1.44101 WP_010989256.1.44160 WP_010989256.1.44180 WP_010989256.1.44196 WP_010989256.1.44248 WP_010989256.1.44262 WP_010989256.1.44268 WP_010989256.1.4427 WP_010989256.1.44296 WP_010989256.1.44343 WP_010989256.1.44351 WP_010989256.1.44360 WP_010989256.1.44416 WP_010989256.1.44431 WP_010989256.1.44437 WP_010989256.1.44546 WP_010989256.1.4468 WP_010989256.1.44762 WP_010989256.1.44815 WP_010989256.1.44828 WP_010989256.1.44879 WP_010989256.1.44917 WP_010989256.1.4501 WP_010989256.1.45072 WP_010989256.1.45093 WP_010989256.1.45136 WP_010989256.1.45241 WP_010989256.1.45435 WP_010989256.1.45523 WP_010989256.1.45596 WP_010989256.1.45648 WP_010989256.1.45829 WP_010989256.1.45871 WP_010989256.1.46030 WP_010989256.1.46077 WP_010989256.1.46169 WP_010989256.1.46225 WP_010989256.1.46241 WP_010989256.1.46307 WP_010989256.1.46355 WP_010989256.1.464 WP_010989256.1.46454 WP_010989256.1.46461 WP_010989256.1.46504 WP_010989256.1.46505 WP_010989256.1.46551 WP_010989256.1.46559 WP_010989256.1.46701 WP_010989256.1.46781 WP_010989256.1.46816 WP_010989256.1.46842 WP_010989256.1.4690 WP_010989256.1.46920 WP_010989256.1.46945 WP_010989256.1.47036 WP_010989256.1.47037 WP_010989256.1.47042 WP_010989256.1.47059 WP_010989256.1.47085 WP_010989256.1.47123 WP_010989256.1.47215 WP_010989256.1.47245 WP_010989256.1.47523 WP_010989256.1.47531 WP_010989256.1.47532 WP_010989256.1.47605 WP_010989256.1.47630 WP_010989256.1.47756 WP_010989256.1.4781 WP_010989256.1.47886 WP_010989256.1.47898 WP_010989256.1.48019 WP_010989256.1.48100 WP_010989256.1.48114 WP_010989256.1.48139 WP_010989256.1.48190 WP_010989256.1.48292 WP_010989256.1.48324 WP_010989256.1.48426 WP_010989256.1.48430 WP_010989256.1.48436 WP_010989256.1.48586 WP_010989256.1.4859 WP_010989256.1.48591 WP_010989256.1.48610 WP_010989256.1.48631 WP_010989256.1.48663 WP_010989256.1.48690 WP_010989256.1.48734 WP_010989256.1.48756 WP_010989256.1.48778 WP_010989256.1.48849 WP_010989256.1.48955 WP_010989256.1.48963 WP_010989256.1.48973 WP_010989256.1.49004 WP_010989256.1.49106 WP_010989256.1.49117 WP_010989256.1.49121 WP_010989256.1.4914 WP_010989256.1.49140 WP_010989256.1.49153 WP_010989256.1.49166 WP_010989256.1.49355 WP_010989256.1.49429 WP_010989256.1.49434 WP_010989256.1.49450 WP_010989256.1.495 WP_010989256.1.49545 WP_010989256.1.49703 WP_010989256.1.49769 WP_010989256.1.49846 WP_010989256.1.4991 WP_010989256.1.49947 WP_010989256.1.49959 WP_010989256.1.49997 WP_010989256.1.50014 WP_010989256.1.50030 WP_010989256.1.50043 WP_010989256.1.50103 WP_010989256.1.50158 WP_010989256.1.50247 WP_010989256.1.50308 WP_010989256.1.50309 WP_010989256.1.50387 WP_010989256.1.50406 WP_010989256.1.50468 WP_010989256.1.5051 WP_010989256.1.50566 WP_010989256.1.50570 WP_010989256.1.50626 WP_010989256.1.50726 WP_010989256.1.50771 WP_010989256.1.50875 WP_010989256.1.50885 WP_010989256.1.509 WP_010989256.1.50929 WP_010989256.1.50970 WP_010989256.1.51040 WP_010989256.1.51048 WP_010989256.1.51100 WP_010989256.1.51134 WP_010989256.1.51227 WP_010989256.1.5127 WP_010989256.1.51305 WP_010989256.1.51315 WP_010989256.1.5136 WP_010989256.1.51474 WP_010989256.1.51519 WP_010989256.1.51598 WP_010989256.1.51724 WP_010989256.1.51734 WP_010989256.1.51838 WP_010989256.1.51863 WP_010989256.1.51935 WP_010989256.1.52057 WP_010989256.1.52129 WP_010989256.1.52191 WP_010989256.1.52202 WP_010989256.1.52209 WP_010989256.1.52339 WP_010989256.1.52469 WP_010989256.1.52571 WP_010989256.1.526 WP_010989256.1.52647 WP_010989256.1.52742 WP_010989256.1.52773 WP_010989256.1.52795 WP_010989256.1.52807 WP_010989256.1.52887 WP_010989256.1.53092 WP_010989256.1.53141 WP_010989256.1.53151 WP_010989256.1.53154 WP_010989256.1.53159 WP_010989256.1.53210 WP_010989256.1.53233 WP_010989256.1.53307 WP_010989256.1.53321 WP_010989256.1.53368 WP_010989256.1.53375 WP_010989256.1.53450 WP_010989256.1.5349 WP_010989256.1.53540 WP_010989256.1.53555 WP_010989256.1.53559 WP_010989256.1.5356 WP_010989256.1.53571 WP_010989256.1.5358 WP_010989256.1.53692 WP_010989256.1.53723 WP_010989256.1.5374 WP_010989256.1.53750 WP_010989256.1.53800 WP_010989256.1.53815 WP_010989256.1.53839 WP_010989256.1.53892 WP_010989256.1.53898 WP_010989256.1.53902 WP_010989256.1.53958 WP_010989256.1.53981 WP_010989256.1.53984 WP_010989256.1.54132 WP_010989256.1.54170 WP_010989256.1.54175 WP_010989256.1.54203 WP_010989256.1.54259 WP_010989256.1.5430 WP_010989256.1.54371 WP_010989256.1.54431 WP_010989256.1.54442 WP_010989256.1.54482 WP_010989256.1.54589 WP_010989256.1.54667 WP_010989256.1.54678 WP_010989256.1.54681 WP_010989256.1.54748 WP_010989256.1.5481 WP_010989256.1.54865 WP_010989256.1.54935 WP_010989256.1.54979 WP_010989256.1.55010 WP_010989256.1.55034 WP_010989256.1.55163 WP_010989256.1.55165 WP_010989256.1.55215 WP_010989256.1.55290 WP_010989256.1.55310 WP_010989256.1.55317 WP_010989256.1.55379 WP_010989256.1.5539 WP_010989256.1.55468 WP_010989256.1.55506 WP_010989256.1.55604 WP_010989256.1.55639 WP_010989256.1.55699 WP_010989256.1.55725 WP_010989256.1.55780 WP_010989256.1.55967 WP_010989256.1.56144 WP_010989256.1.56172 WP_010989256.1.5621 WP_010989256.1.56226 WP_010989256.1.56311 WP_010989256.1.56419 WP_010989256.1.56423 WP_010989256.1.56514 WP_010989256.1.56535 WP_010989256.1.56585 WP_010989256.1.56640 WP_010989256.1.56724 WP_010989256.1.56825 WP_010989256.1.56887 WP_010989256.1.56889 WP_010989256.1.56981 WP_010989256.1.57101 WP_010989256.1.57137 WP_010989256.1.57147 WP_010989256.1.57179 WP_010989256.1.57186 WP_010989256.1.57342 WP_010989256.1.57684 WP_010989256.1.57699 WP_010989256.1.57785 WP_010989256.1.57800 WP_010989256.1.57873 WP_010989256.1.57965 WP_010989256.1.57972 WP_010989256.1.58008 WP_010989256.1.58044 WP_010989256.1.58081 WP_010989256.1.5809 WP_010989256.1.58132 WP_010989256.1.58173 WP_010989256.1.58191 WP_010989256.1.58194 WP_010989256.1.58252 WP_010989256.1.58261 WP_010989256.1.58274 WP_010989256.1.58282 WP_010989256.1.58324 WP_010989256.1.58326 WP_010989256.1.5836 WP_010989256.1.58485 WP_010989256.1.58537 WP_010989256.1.58568 WP_010989256.1.58583 WP_010989256.1.58652 WP_010989256.1.58663 WP_010989256.1.58724 WP_010989256.1.5875 WP_010989256.1.58796 WP_010989256.1.58807 WP_010989256.1.58847 WP_010989256.1.58883 WP_010989256.1.58898 WP_010989256.1.58949 WP_010989256.1.58963 WP_010989256.1.58970 WP_010989256.1.58974 WP_010989256.1.59020 WP_010989256.1.59043 WP_010989256.1.59056 WP_010989256.1.59061 WP_010989256.1.59064 WP_010989256.1.59282 WP_010989256.1.59299 WP_010989256.1.59313 WP_010989256.1.5949 WP_010989256.1.59501 WP_010989256.1.59510 WP_010989256.1.5969 WP_010989256.1.59751 WP_010989256.1.59827 WP_010989256.1.59829 WP_010989256.1.59847 WP_010989256.1.59863 WP_010989256.1.59969 WP_010989256.1.59994 WP_010989256.1.60045 WP_010989256.1.60076 WP_010989256.1.60114 WP_010989256.1.60154 WP_010989256.1.60168 WP_010989256.1.60192 WP_010989256.1.60199 WP_010989256.1.60212 WP_010989256.1.60253 WP_010989256.1.60322 WP_010989256.1.60324 WP_010989256.1.60356 WP_010989256.1.6038 WP_010989256.1.60380 WP_010989256.1.6041 WP_010989256.1.60424 WP_010989256.1.60481 WP_010989256.1.605 WP_010989256.1.6058 WP_010989256.1.60584 WP_010989256.1.6060 WP_010989256.1.60676 WP_010989256.1.60708 WP_010989256.1.60725 WP_010989256.1.60783 WP_010989256.1.60792 WP_010989256.1.60807 WP_010989256.1.60882 WP_010989256.1.60889 WP_010989256.1.60950 WP_010989256.1.6104 WP_010989256.1.61044 WP_010989256.1.61076 WP_010989256.1.61123 WP_010989256.1.61147 WP_010989256.1.61168 WP_010989256.1.61210 WP_010989256.1.61357 WP_010989256.1.61511 WP_010989256.1.61539 WP_010989256.1.61542 WP_010989256.1.61553 WP_010989256.1.61649 WP_010989256.1.61652 WP_010989256.1.61697 WP_010989256.1.61809 WP_010989256.1.61877 WP_010989256.1.61920 WP_010989256.1.62124 WP_010989256.1.62199 WP_010989256.1.62223 WP_010989256.1.62302 WP_010989256.1.62314 WP_010989256.1.62323 WP_010989256.1.62333 WP_010989256.1.62338 WP_010989256.1.62380 WP_010989256.1.62411 WP_010989256.1.62436 WP_010989256.1.62475 WP_010989256.1.62536 WP_010989256.1.62640 WP_010989256.1.62686 WP_010989256.1.62751 WP_010989256.1.62825 WP_010989256.1.62913 WP_010989256.1.62960 WP_010989256.1.63016 WP_010989256.1.63025 WP_010989256.1.63069 WP_010989256.1.63087 WP_010989256.1.63169 WP_010989256.1.63297 WP_010989256.1.63448 WP_010989256.1.63514 WP_010989256.1.63583 WP_010989256.1.63592 WP_010989256.1.63663 WP_010989256.1.63736 WP_010989256.1.63816 WP_010989256.1.63876 WP_010989256.1.6389 WP_010989256.1.63901 WP_010989256.1.63955 WP_010989256.1.63963 WP_010989256.1.64032 WP_010989256.1.64087 WP_010989256.1.6415 WP_010989256.1.64293 WP_010989256.1.64332 WP_010989256.1.64376 WP_010989256.1.644 WP_010989256.1.64471 WP_010989256.1.64501 WP_010989256.1.64538 WP_010989256.1.64632 WP_010989256.1.64648 WP_010989256.1.64654 WP_010989256.1.64662 WP_010989256.1.64663 WP_010989256.1.64709 WP_010989256.1.64710 WP_010989256.1.64744 WP_010989256.1.64763 WP_010989256.1.64817 WP_010989256.1.64847 WP_010989256.1.6487 WP_010989256.1.64891 WP_010989256.1.64974 WP_010989256.1.65054 WP_010989256.1.65075 WP_010989256.1.6514 WP_010989256.1.65172 WP_010989256.1.65191 WP_010989256.1.65200 WP_010989256.1.65211 WP_010989256.1.65218 WP_010989256.1.65226 WP_010989256.1.65249 WP_010989256.1.65266 WP_010989256.1.65395 WP_010989256.1.65459 WP_010989256.1.65463 WP_010989256.1.65487 WP_010989256.1.6549 WP_010989256.1.65499 WP_010989256.1.6554 WP_010989256.1.65650 WP_010989256.1.65697 WP_010989256.1.65699 WP_010989256.1.65737 WP_010989256.1.65755 WP_010989256.1.65812 WP_010989256.1.65846 WP_010989256.1.65863 WP_010989256.1.65985 WP_010989256.1.66021 WP_010989256.1.66031 WP_010989256.1.66052 WP_010989256.1.66064 WP_010989256.1.66109 WP_010989256.1.66145 WP_010989256.1.66183 WP_010989256.1.6620 WP_010989256.1.66216 WP_010989256.1.66234 WP_010989256.1.66273 WP_010989256.1.66324 WP_010989256.1.6634 WP_010989256.1.66361 WP_010989256.1.66480 WP_010989256.1.66506 WP_010989256.1.66665 WP_010989256.1.66681 WP_010989256.1.66684 WP_010989256.1.66755 WP_010989256.1.66759 WP_010989256.1.66801 WP_010989256.1.66860 WP_010989256.1.66953 WP_010989256.1.66955 WP_010989256.1.66981 WP_010989256.1.67024 WP_010989256.1.67042 WP_010989256.1.67101 WP_010989256.1.67143 WP_010989256.1.67201 WP_010989256.1.67211 WP_010989256.1.67237 WP_010989256.1.67336 WP_010989256.1.67339 WP_010989256.1.67387 WP_010989256.1.67394 WP_010989256.1.67397 WP_010989256.1.67403 WP_010989256.1.67430 WP_010989256.1.67442 WP_010989256.1.67539 WP_010989256.1.67556 WP_010989256.1.67576 WP_010989256.1.67604 WP_010989256.1.67619 WP_010989256.1.67625 WP_010989256.1.67627 WP_010989256.1.67641 WP_010989256.1.67657 WP_010989256.1.67673 WP_010989256.1.67700 WP_010989256.1.67718 WP_010989256.1.67729 WP_010989256.1.67774 WP_010989256.1.67820 WP_010989256.1.67910 WP_010989256.1.67954 WP_010989256.1.68 WP_010989256.1.68043 WP_010989256.1.68105 WP_010989256.1.68113 WP_010989256.1.68131 WP_010989256.1.68182 WP_010989256.1.6819 WP_010989256.1.68285 WP_010989256.1.68359 WP_010989256.1.68420 WP_010989256.1.68514 WP_010989256.1.68564 WP_010989256.1.68688 WP_010989256.1.68742 WP_010989256.1.68770 WP_010989256.1.68809 WP_010989256.1.68914 WP_010989256.1.69053 WP_010989256.1.69170 WP_010989256.1.69210 WP_010989256.1.69270 WP_010989256.1.69282 WP_010989256.1.69376 WP_010989256.1.69396 WP_010989256.1.69466 WP_010989256.1.69611 WP_010989256.1.69642 WP_010989256.1.69656 WP_010989256.1.69657 WP_010989256.1.69690 WP_010989256.1.69923 WP_010989256.1.69948 WP_010989256.1.69953 WP_010989256.1.70010 WP_010989256.1.70049 WP_010989256.1.70058 WP_010989256.1.70061 WP_010989256.1.70205 WP_010989256.1.70240 WP_010989256.1.70249 WP_010989256.1.70261 WP_010989256.1.70314 WP_010989256.1.7033 WP_010989256.1.70427 WP_010989256.1.70433 WP_010989256.1.70545 WP_010989256.1.70623 WP_010989256.1.70671 WP_010989256.1.70679 WP_010989256.1.70708 WP_010989256.1.70717 WP_010989256.1.70731 WP_010989256.1.70772 WP_010989256.1.70845 WP_010989256.1.70846 WP_010989256.1.70981 WP_010989256.1.70995 WP_010989256.1.71039 WP_010989256.1.71057 WP_010989256.1.71081 WP_010989256.1.71117 WP_010989256.1.71186 WP_010989256.1.71455 WP_010989256.1.71456 WP_010989256.1.71487 WP_010989256.1.71523 WP_010989256.1.71542 WP_010989256.1.71566 WP_010989256.1.71640 WP_010989256.1.71651 WP_010989256.1.71653 WP_010989256.1.71716 WP_010989256.1.71872 WP_010989256.1.71950 WP_010989256.1.71954 WP_010989256.1.71985 WP_010989256.1.72003 WP_010989256.1.72073 WP_010989256.1.72269 WP_010989256.1.72350 WP_010989256.1.72383 WP_010989256.1.72461 WP_010989256.1.72527 WP_010989256.1.7255 WP_010989256.1.72631 WP_010989256.1.72638 WP_010989256.1.72667 WP_010989256.1.72674 WP_010989256.1.72724 WP_010989256.1.72789 WP_010989256.1.72828 WP_010989256.1.72896 WP_010989256.1.72969 WP_010989256.1.72987 WP_010989256.1.73052 WP_010989256.1.7311 WP_010989256.1.73114 WP_010989256.1.73177 WP_010989256.1.73180 WP_010989256.1.73258 WP_010989256.1.73285 WP_010989256.1.7332 WP_010989256.1.7333 WP_010989256.1.73352 WP_010989256.1.73389 WP_010989256.1.73425 WP_010989256.1.73488 WP_010989256.1.73504 WP_010989256.1.7353 WP_010989256.1.73544 WP_010989256.1.73598 WP_010989256.1.7361 WP_010989256.1.73648 WP_010989256.1.73768 WP_010989256.1.73849 WP_010989256.1.73948 WP_010989256.1.73999 WP_010989256.1.74024 WP_010989256.1.74030 WP_010989256.1.74038 WP_010989256.1.74043 WP_010989256.1.74058 WP_010989256.1.74070 WP_010989256.1.74077 WP_010989256.1.74135 WP_010989256.1.74214 WP_010989256.1.74241 WP_010989256.1.74285 WP_010989256.1.7430 WP_010989256.1.74317 WP_010989256.1.74415 WP_010989256.1.74616 WP_010989256.1.74621 WP_010989256.1.74647 WP_010989256.1.74677 WP_010989256.1.74699 WP_010989256.1.74831 WP_010989256.1.74894 WP_010989256.1.74929 WP_010989256.1.74939 WP_010989256.1.74973 WP_010989256.1.7507 WP_010989256.1.75089 WP_010989256.1.75116 WP_010989256.1.75237 WP_010989256.1.75273 WP_010989256.1.75296 WP_010989256.1.75413 WP_010989256.1.75433 WP_010989256.1.75532 WP_010989256.1.75565 WP_010989256.1.75593 WP_010989256.1.75610 WP_010989256.1.75633 WP_010989256.1.75718 WP_010989256.1.75745 WP_010989256.1.75844 WP_010989256.1.75886 WP_010989256.1.75898 WP_010989256.1.76081 WP_010989256.1.76116 WP_010989256.1.76122 WP_010989256.1.76256 WP_010989256.1.76339 WP_010989256.1.76366 WP_010989256.1.76417 WP_010989256.1.7646 WP_010989256.1.76510 WP_010989256.1.76558 WP_010989256.1.76572 WP_010989256.1.76641 WP_010989256.1.76651 WP_010989256.1.76653 WP_010989256.1.76788 WP_010989256.1.76854 WP_010989256.1.76916 WP_010989256.1.76932 WP_010989256.1.76973 WP_010989256.1.76988 WP_010989256.1.77016 WP_010989256.1.77087 WP_010989256.1.77090 WP_010989256.1.77111 WP_010989256.1.77299 WP_010989256.1.77384 WP_010989256.1.77501 WP_010989256.1.77512 WP_010989256.1.77513 WP_010989256.1.77563 WP_010989256.1.77702 WP_010989256.1.77713 WP_010989256.1.7772 WP_010989256.1.77825 WP_010989256.1.77837 WP_010989256.1.77900 WP_010989256.1.77923 WP_010989256.1.78035 WP_010989256.1.78048 WP_010989256.1.78107 WP_010989256.1.78166 WP_010989256.1.78192 WP_010989256.1.78195 WP_010989256.1.78291 WP_010989256.1.78309 WP_010989256.1.78320 WP_010989256.1.78382 WP_010989256.1.78388 WP_010989256.1.78410 WP_010989256.1.7862 WP_010989256.1.78661 WP_010989256.1.78674 WP_010989256.1.78676 WP_010989256.1.78761 WP_010989256.1.789 WP_010989256.1.78993 WP_010989256.1.79012 WP_010989256.1.79069 WP_010989256.1.79074 WP_010989256.1.79098 WP_010989256.1.79155 WP_010989256.1.79164 WP_010989256.1.79204 WP_010989256.1.79280 WP_010989256.1.79397 WP_010989256.1.79456 WP_010989256.1.79532 WP_010989256.1.79547 WP_010989256.1.79654 WP_010989256.1.7970 WP_010989256.1.79722 WP_010989256.1.79772 WP_010989256.1.79880 WP_010989256.1.79916 WP_010989256.1.80065 WP_010989256.1.80103 WP_010989256.1.80273 WP_010989256.1.80282 WP_010989256.1.80354 WP_010989256.1.80368 WP_010989256.1.80386 WP_010989256.1.80400 WP_010989256.1.80462 WP_010989256.1.8049 WP_010989256.1.80492 WP_010989256.1.80569 WP_010989256.1.80664 WP_010989256.1.80696 WP_010989256.1.80984 WP_010989256.1.81131 WP_010989256.1.81187 WP_010989256.1.81262 WP_010989256.1.81268 WP_010989256.1.81269 WP_010989256.1.81271 WP_010989256.1.8131 WP_010989256.1.81333 WP_010989256.1.81342 WP_010989256.1.81364 WP_010989256.1.81494 WP_010989256.1.81557 WP_010989256.1.81676 WP_010989256.1.81681 WP_010989256.1.8170 WP_010989256.1.81763 WP_010989256.1.81855 WP_010989256.1.81921 WP_010989256.1.81931 WP_010989256.1.81936 WP_010989256.1.81949 WP_010989256.1.82070 WP_010989256.1.82076 WP_010989256.1.82131 WP_010989256.1.82156 WP_010989256.1.8218 WP_010989256.1.82180 WP_010989256.1.82201 WP_010989256.1.82214 WP_010989256.1.82225 WP_010989256.1.8240 WP_010989256.1.82408 WP_010989256.1.82416 WP_010989256.1.8242 WP_010989256.1.82456 WP_010989256.1.82465 WP_010989256.1.82473 WP_010989256.1.82553 WP_010989256.1.82646 WP_010989256.1.82670 WP_010989256.1.82731 WP_010989256.1.82812 WP_010989256.1.82850 WP_010989256.1.82872 WP_010989256.1.8294 WP_010989256.1.82959 WP_010989256.1.83007 WP_010989256.1.8304 WP_010989256.1.83180 WP_010989256.1.83229 WP_010989256.1.83235 WP_010989256.1.83290 WP_010989256.1.83333 WP_010989256.1.83657 WP_010989256.1.83677 WP_010989256.1.8375 WP_010989256.1.83923 WP_010989256.1.83994 WP_010989256.1.84 WP_010989256.1.8406 WP_010989256.1.84076 WP_010989256.1.84110 WP_010989256.1.84127 WP_010989256.1.84150 WP_010989256.1.84230 WP_010989256.1.84252 WP_010989256.1.8431 WP_010989256.1.84345 WP_010989256.1.84369 WP_010989256.1.84401 WP_010989256.1.84435 WP_010989256.1.84567 WP_010989256.1.84631 WP_010989256.1.84727 WP_010989256.1.84744 WP_010989256.1.84773 WP_010989256.1.84945 WP_010989256.1.84967 WP_010989256.1.85004 WP_010989256.1.8502 WP_010989256.1.85039 WP_010989256.1.85153 WP_010989256.1.85273 WP_010989256.1.85338 WP_010989256.1.85339 WP_010989256.1.85511 WP_010989256.1.85512 WP_010989256.1.8557 WP_010989256.1.85606 WP_010989256.1.85635 WP_010989256.1.85646 WP_010989256.1.85665 WP_010989256.1.85669 WP_010989256.1.85688 WP_010989256.1.85703 WP_010989256.1.85728 WP_010989256.1.85746 WP_010989256.1.85811 WP_010989256.1.859 WP_010989256.1.85917 WP_010989256.1.8594 WP_010989256.1.85977 WP_010989256.1.860 WP_010989256.1.8605 WP_010989256.1.86084 WP_010989256.1.8610 WP_010989256.1.8614 WP_010989256.1.86156 WP_010989256.1.86323 WP_010989256.1.86342 WP_010989256.1.8640 WP_010989256.1.8642 WP_010989256.1.86426 WP_010989256.1.86489 WP_010989256.1.86530 WP_010989256.1.86663 WP_010989256.1.86770 WP_010989256.1.86794 WP_010989256.1.86800 WP_010989256.1.86811 WP_010989256.1.86815 WP_010989256.1.86945 WP_010989256.1.86989 WP_010989256.1.87023 WP_010989256.1.87034 WP_010989256.1.87041 WP_010989256.1.87136 WP_010989256.1.87155 WP_010989256.1.87258 WP_010989256.1.87293 WP_010989256.1.87420 WP_010989256.1.87528 WP_010989256.1.87560 WP_010989256.1.8760 WP_010989256.1.87600 WP_010989256.1.87609 WP_010989256.1.87612 WP_010989256.1.87615 WP_010989256.1.87653 WP_010989256.1.87698 WP_010989256.1.87706 WP_010989256.1.87739 WP_010989256.1.87741 WP_010989256.1.87742 WP_010989256.1.87852 WP_010989256.1.87949 WP_010989256.1.88025 WP_010989256.1.88026 WP_010989256.1.8805 WP_010989256.1.8806 WP_010989256.1.881 WP_010989256.1.88145 WP_010989256.1.88199 WP_010989256.1.88299 WP_010989256.1.88313 WP_010989256.1.88359 WP_010989256.1.88407 WP_010989256.1.88414 WP_010989256.1.88444 WP_010989256.1.88446 WP_010989256.1.88458 WP_010989256.1.88501 WP_010989256.1.88538 WP_010989256.1.88547 WP_010989256.1.886 WP_010989256.1.88647 WP_010989256.1.88648 WP_010989256.1.88692 WP_010989256.1.88707 WP_010989256.1.88727 WP_010989256.1.88772 WP_010989256.1.88850 WP_010989256.1.8889 WP_010989256.1.88892 WP_010989256.1.88894 WP_010989256.1.89182 WP_010989256.1.89298 WP_010989256.1.89308 WP_010989256.1.89314 WP_010989256.1.89328 WP_010989256.1.89332 WP_010989256.1.89343 WP_010989256.1.89395 WP_010989256.1.8940 WP_010989256.1.89449 WP_010989256.1.8947 WP_010989256.1.89503 WP_010989256.1.89591 WP_010989256.1.89612 WP_010989256.1.89668 WP_010989256.1.89706 WP_010989256.1.89713 WP_010989256.1.89733 WP_010989256.1.89796 WP_010989256.1.89804 WP_010989256.1.89845 WP_010989256.1.89888 WP_010989256.1.89911 WP_010989256.1.8995 WP_010989256.1.89952 WP_010989256.1.90007 WP_010989256.1.9011 WP_010989256.1.90196 WP_010989256.1.90240 WP_010989256.1.90274 WP_010989256.1.90280 WP_010989256.1.90330 WP_010989256.1.90338 WP_010989256.1.90365 WP_010989256.1.90428 WP_010989256.1.90489 WP_010989256.1.90513 WP_010989256.1.90582 WP_010989256.1.90713 WP_010989256.1.90794 WP_010989256.1.90796 WP_010989256.1.90811 WP_010989256.1.9091 WP_010989256.1.91067 WP_010989256.1.91164 WP_010989256.1.91205 WP_010989256.1.91239 WP_010989256.1.91291 WP_010989256.1.9135 WP_010989256.1.91506 WP_010989256.1.91557 WP_010989256.1.91597 WP_010989256.1.91715 WP_010989256.1.9187 WP_010989256.1.91870 WP_010989256.1.92018 WP_010989256.1.92087 WP_010989256.1.92098 WP_010989256.1.92156 WP_010989256.1.92172 WP_010989256.1.92240 WP_010989256.1.92243 WP_010989256.1.92327 WP_010989256.1.92470 WP_010989256.1.92477 WP_010989256.1.92545 WP_010989256.1.92570 WP_010989256.1.92588 WP_010989256.1.926 WP_010989256.1.92633 WP_010989256.1.92649 WP_010989256.1.92676 WP_010989256.1.92705 WP_010989256.1.9271 WP_010989256.1.92734 WP_010989256.1.92810 WP_010989256.1.92823 WP_010989256.1.92987 WP_010989256.1.93007 WP_010989256.1.93022 WP_010989256.1.93103 WP_010989256.1.93105 WP_010989256.1.93111 WP_010989256.1.93121 WP_010989256.1.93168 WP_010989256.1.93184 WP_010989256.1.93221 WP_010989256.1.93223 WP_010989256.1.93239 WP_010989256.1.93302 WP_010989256.1.9336 WP_010989256.1.93387 WP_010989256.1.93469 WP_010989256.1.93511 WP_010989256.1.93512 WP_010989256.1.93635 WP_010989256.1.93657 WP_010989256.1.9374 WP_010989256.1.9375 WP_010989256.1.93754 WP_010989256.1.93780 WP_010989256.1.93828 WP_010989256.1.93842 WP_010989256.1.93843 WP_010989256.1.93875 WP_010989256.1.93909 WP_010989256.1.93919 WP_010989256.1.93938 WP_010989256.1.93984 WP_010989256.1.9399 WP_010989256.1.94017 WP_010989256.1.94079 WP_010989256.1.94097 WP_010989256.1.94107 WP_010989256.1.94142 WP_010989256.1.94215 WP_010989256.1.94303 WP_010989256.1.94365 WP_010989256.1.94390 WP_010989256.1.94415 WP_010989256.1.94492 WP_010989256.1.94510 WP_010989256.1.94527 WP_010989256.1.94573 WP_010989256.1.94579 WP_010989256.1.94586 WP_010989256.1.94593 WP_010989256.1.94650 WP_010989256.1.94659 WP_010989256.1.94662 WP_010989256.1.94700 WP_010989256.1.94745 WP_010989256.1.94782 WP_010989256.1.94820 WP_010989256.1.94850 WP_010989256.1.94851 WP_010989256.1.94864 WP_010989256.1.94952 WP_010989256.1.95006 WP_010989256.1.95055 WP_010989256.1.95076 WP_010989256.1.95099 WP_010989256.1.95165 WP_010989256.1.95239 WP_010989256.1.95246 WP_010989256.1.9525 WP_010989256.1.95255 WP_010989256.1.95265 WP_010989256.1.95338 WP_010989256.1.95412 WP_010989256.1.95530 WP_010989256.1.95547 WP_010989256.1.95590 WP_010989256.1.95625 WP_010989256.1.95675 WP_010989256.1.95716 WP_010989256.1.95776 WP_010989256.1.95890 WP_010989256.1.95906 WP_010989256.1.96025 WP_010989256.1.96044 WP_010989256.1.96054 WP_010989256.1.96094 WP_010989256.1.96127 WP_010989256.1.96144 WP_010989256.1.96188 WP_010989256.1.96211 WP_010989256.1.96212 WP_010989256.1.96319 WP_010989256.1.9633 WP_010989256.1.96359 WP_010989256.1.96539 WP_010989256.1.96552 WP_010989256.1.96610 WP_010989256.1.96625 WP_010989256.1.96635 WP_010989256.1.9664 WP_010989256.1.96675 WP_010989256.1.9670 WP_010989256.1.96750 WP_010989256.1.96792 WP_010989256.1.96801 WP_010989256.1.96803 WP_010989256.1.96925 WP_010989256.1.96938 WP_010989256.1.96946 WP_010989256.1.96957 WP_010989256.1.96978 WP_010989256.1.97026 WP_010989256.1.97028 WP_010989256.1.97079 WP_010989256.1.97154 WP_010989256.1.97184 WP_010989256.1.97287 WP_010989256.1.97291 WP_010989256.1.97422 WP_010989256.1.97441 WP_010989256.1.97497 WP_010989256.1.97505 WP_010989256.1.97599 WP_010989256.1.97606 WP_010989256.1.97615 WP_010989256.1.97646 WP_010989256.1.97690 WP_010989256.1.97819 WP_010989256.1.97840 WP_010989256.1.97938 WP_010989256.1.97986 WP_010989256.1.98036 WP_010989256.1.98080 WP_010989256.1.98086 WP_010989256.1.98158 WP_010989256.1.98263 WP_010989256.1.98418 WP_010989256.1.98448 WP_010989256.1.98457 WP_010989256.1.9850 WP_010989256.1.98502 WP_010989256.1.98607 WP_010989256.1.98731 WP_010989256.1.98762 WP_010989256.1.9877 WP_010989256.1.98801 WP_010989256.1.98818 WP_010989256.1.99163 WP_010989256.1.99335 WP_010989256.1.99350 WP_010989256.1.99360 WP_010989256.1.99363 WP_010989256.1.99369 WP_010989256.1.99388 WP_010989256.1.99397 WP_010989256.1.99463 WP_010989256.1.99483 WP_010989256.1.99546 WP_010989256.1.99579 WP_010989256.1.99595 WP_010989256.1.99676 WP_010989256.1.99764 WP_010989256.1.99829 WP_010989256.1.99837 WP_010989256.1.99841 WP_010989256.1.9992 WP_010989256.1.99996 gi|29143820|ref|NP_807162.1| gi|16762332|ref|NP_457949.1| AE014613|CDS_3613980-3612721 AL513382|CDS_3628320-3627061 209261.t3514 220341.STY3764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]