SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16762336|ref|NP_457953.1| from Salmonella enterica subsp. enterica serovar Typhi str. CT18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16762336|ref|NP_457953.1|
Domain Number 1 Region: 5-381
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.28e-117
Family Cystathionine synthase-like 0.00000000000322
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16762336|ref|NP_457953.1|
Sequence length 386
Comment cystathionine gamma-synthase [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
Sequence
MTRKQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFTGFNEPRAHDYSRRGNPTRDVVQRA
LAELEGGAGAVLTNTGMSAIHLVTTVFLKPGDLLVAPHDCYGGSYRLFDSLATRGCYRVR
FVDQGDERALQAALEEKPKLVLVESPSNPLLRVVDIAKICRLAREAGAVSVVDNTFLSPA
LQNPLALGADLVLHSCTKYLNGHSDVVAGVMIAKDPEMVTELAWWANNIGVTGGAFDSYL
LLRGLRTLVPRMELAQRNAQAIVKYLQTQPLVKKLYHPSLPNNQGHEIAARQQKGFGAML
SFELDGDEETLRRFLGGLSLFTLAESLGGVESLISHAATMTHAGMSPQARAAAGISETLL
RISTGIEDGEDLIADLENGFRAANKG
Download sequence
Identical sequences Q8Z2Z5
gi|488655956|ref|YP_007927759.1| gi|378961679|ref|YP_005219165.1| gi|16762336|ref|NP_457953.1| gi|29143824|ref|NP_807166.1| NP_457953.1.84458 WP_000197208.1.100008 WP_000197208.1.100036 WP_000197208.1.100079 WP_000197208.1.100196 WP_000197208.1.100284 WP_000197208.1.100313 WP_000197208.1.100314 WP_000197208.1.100321 WP_000197208.1.100354 WP_000197208.1.100421 WP_000197208.1.100446 WP_000197208.1.100450 WP_000197208.1.100592 WP_000197208.1.100610 WP_000197208.1.100732 WP_000197208.1.100733 WP_000197208.1.100739 WP_000197208.1.100764 WP_000197208.1.100799 WP_000197208.1.100941 WP_000197208.1.100953 WP_000197208.1.101011 WP_000197208.1.10108 WP_000197208.1.101226 WP_000197208.1.10124 WP_000197208.1.101271 WP_000197208.1.101312 WP_000197208.1.101322 WP_000197208.1.101374 WP_000197208.1.101616 WP_000197208.1.101890 WP_000197208.1.101941 WP_000197208.1.102050 WP_000197208.1.102087 WP_000197208.1.10338 WP_000197208.1.1038 WP_000197208.1.104 WP_000197208.1.10401 WP_000197208.1.10428 WP_000197208.1.10459 WP_000197208.1.10475 WP_000197208.1.10511 WP_000197208.1.10514 WP_000197208.1.10530 WP_000197208.1.10532 WP_000197208.1.10547 WP_000197208.1.10595 WP_000197208.1.10642 WP_000197208.1.10654 WP_000197208.1.10677 WP_000197208.1.10857 WP_000197208.1.10873 WP_000197208.1.10926 WP_000197208.1.10936 WP_000197208.1.11012 WP_000197208.1.11055 WP_000197208.1.11126 WP_000197208.1.11142 WP_000197208.1.11239 WP_000197208.1.11253 WP_000197208.1.11314 WP_000197208.1.11385 WP_000197208.1.1142 WP_000197208.1.11426 WP_000197208.1.11429 WP_000197208.1.11557 WP_000197208.1.11567 WP_000197208.1.11638 WP_000197208.1.11883 WP_000197208.1.11908 WP_000197208.1.11914 WP_000197208.1.12040 WP_000197208.1.12061 WP_000197208.1.1207 WP_000197208.1.12141 WP_000197208.1.12172 WP_000197208.1.12192 WP_000197208.1.1224 WP_000197208.1.12364 WP_000197208.1.12398 WP_000197208.1.12441 WP_000197208.1.12581 WP_000197208.1.12620 WP_000197208.1.12648 WP_000197208.1.12683 WP_000197208.1.12726 WP_000197208.1.12727 WP_000197208.1.12741 WP_000197208.1.12834 WP_000197208.1.13108 WP_000197208.1.13161 WP_000197208.1.1321 WP_000197208.1.13268 WP_000197208.1.13291 WP_000197208.1.133 WP_000197208.1.13314 WP_000197208.1.13338 WP_000197208.1.13342 WP_000197208.1.13352 WP_000197208.1.13406 WP_000197208.1.13440 WP_000197208.1.13443 WP_000197208.1.13476 WP_000197208.1.13599 WP_000197208.1.13686 WP_000197208.1.1372 WP_000197208.1.13732 WP_000197208.1.1382 WP_000197208.1.1397 WP_000197208.1.13972 WP_000197208.1.140 WP_000197208.1.1401 WP_000197208.1.1408 WP_000197208.1.14089 WP_000197208.1.14099 WP_000197208.1.14120 WP_000197208.1.14123 WP_000197208.1.14150 WP_000197208.1.14191 WP_000197208.1.14197 WP_000197208.1.14280 WP_000197208.1.14333 WP_000197208.1.14399 WP_000197208.1.14444 WP_000197208.1.14467 WP_000197208.1.14474 WP_000197208.1.14500 WP_000197208.1.14526 WP_000197208.1.14550 WP_000197208.1.14575 WP_000197208.1.14701 WP_000197208.1.14703 WP_000197208.1.14719 WP_000197208.1.1473 WP_000197208.1.14765 WP_000197208.1.14810 WP_000197208.1.14877 WP_000197208.1.14894 WP_000197208.1.14930 WP_000197208.1.14947 WP_000197208.1.14948 WP_000197208.1.15184 WP_000197208.1.15244 WP_000197208.1.15265 WP_000197208.1.15362 WP_000197208.1.15415 WP_000197208.1.15423 WP_000197208.1.15433 WP_000197208.1.15439 WP_000197208.1.15487 WP_000197208.1.15535 WP_000197208.1.15581 WP_000197208.1.15597 WP_000197208.1.15710 WP_000197208.1.15717 WP_000197208.1.15905 WP_000197208.1.15912 WP_000197208.1.15970 WP_000197208.1.16046 WP_000197208.1.16051 WP_000197208.1.16058 WP_000197208.1.16150 WP_000197208.1.16155 WP_000197208.1.1626 WP_000197208.1.16264 WP_000197208.1.16344 WP_000197208.1.16452 WP_000197208.1.16461 WP_000197208.1.16462 WP_000197208.1.16465 WP_000197208.1.16522 WP_000197208.1.16588 WP_000197208.1.16658 WP_000197208.1.16666 WP_000197208.1.16673 WP_000197208.1.1674 WP_000197208.1.16767 WP_000197208.1.16781 WP_000197208.1.16879 WP_000197208.1.16893 WP_000197208.1.16905 WP_000197208.1.16948 WP_000197208.1.17049 WP_000197208.1.17058 WP_000197208.1.17078 WP_000197208.1.17202 WP_000197208.1.17219 WP_000197208.1.1722 WP_000197208.1.17302 WP_000197208.1.17308 WP_000197208.1.17368 WP_000197208.1.17405 WP_000197208.1.17406 WP_000197208.1.17513 WP_000197208.1.17543 WP_000197208.1.17563 WP_000197208.1.17578 WP_000197208.1.17622 WP_000197208.1.17659 WP_000197208.1.17667 WP_000197208.1.17686 WP_000197208.1.17741 WP_000197208.1.17840 WP_000197208.1.17956 WP_000197208.1.18005 WP_000197208.1.1801 WP_000197208.1.18021 WP_000197208.1.18099 WP_000197208.1.18124 WP_000197208.1.18144 WP_000197208.1.18173 WP_000197208.1.18270 WP_000197208.1.18280 WP_000197208.1.18328 WP_000197208.1.18358 WP_000197208.1.18370 WP_000197208.1.18406 WP_000197208.1.18474 WP_000197208.1.18513 WP_000197208.1.18610 WP_000197208.1.18678 WP_000197208.1.18722 WP_000197208.1.18766 WP_000197208.1.1880 WP_000197208.1.1885 WP_000197208.1.18860 WP_000197208.1.18922 WP_000197208.1.18959 WP_000197208.1.19001 WP_000197208.1.19006 WP_000197208.1.19044 WP_000197208.1.19084 WP_000197208.1.19187 WP_000197208.1.19228 WP_000197208.1.19288 WP_000197208.1.19300 WP_000197208.1.19422 WP_000197208.1.19454 WP_000197208.1.19456 WP_000197208.1.19496 WP_000197208.1.19535 WP_000197208.1.19538 WP_000197208.1.19589 WP_000197208.1.19663 WP_000197208.1.19686 WP_000197208.1.19731 WP_000197208.1.19794 WP_000197208.1.1992 WP_000197208.1.19999 WP_000197208.1.20254 WP_000197208.1.20255 WP_000197208.1.20296 WP_000197208.1.20339 WP_000197208.1.20419 WP_000197208.1.20465 WP_000197208.1.20492 WP_000197208.1.2053 WP_000197208.1.20635 WP_000197208.1.20718 WP_000197208.1.2073 WP_000197208.1.20740 WP_000197208.1.20828 WP_000197208.1.2087 WP_000197208.1.20883 WP_000197208.1.20947 WP_000197208.1.20953 WP_000197208.1.21010 WP_000197208.1.2106 WP_000197208.1.21062 WP_000197208.1.21144 WP_000197208.1.21162 WP_000197208.1.21184 WP_000197208.1.21185 WP_000197208.1.21366 WP_000197208.1.21492 WP_000197208.1.2166 WP_000197208.1.21674 WP_000197208.1.21946 WP_000197208.1.21966 WP_000197208.1.22064 WP_000197208.1.22118 WP_000197208.1.22126 WP_000197208.1.2216 WP_000197208.1.22208 WP_000197208.1.2227 WP_000197208.1.22373 WP_000197208.1.22476 WP_000197208.1.22614 WP_000197208.1.22652 WP_000197208.1.22683 WP_000197208.1.2284 WP_000197208.1.22895 WP_000197208.1.22926 WP_000197208.1.22943 WP_000197208.1.22967 WP_000197208.1.23040 WP_000197208.1.23058 WP_000197208.1.23218 WP_000197208.1.2331 WP_000197208.1.2332 WP_000197208.1.23340 WP_000197208.1.2336 WP_000197208.1.23365 WP_000197208.1.23412 WP_000197208.1.23426 WP_000197208.1.23492 WP_000197208.1.23515 WP_000197208.1.23548 WP_000197208.1.23571 WP_000197208.1.23604 WP_000197208.1.23728 WP_000197208.1.2375 WP_000197208.1.23783 WP_000197208.1.23786 WP_000197208.1.23787 WP_000197208.1.23801 WP_000197208.1.24028 WP_000197208.1.24061 WP_000197208.1.24083 WP_000197208.1.24117 WP_000197208.1.24125 WP_000197208.1.24138 WP_000197208.1.24153 WP_000197208.1.24291 WP_000197208.1.24322 WP_000197208.1.24355 WP_000197208.1.24375 WP_000197208.1.24400 WP_000197208.1.24420 WP_000197208.1.24619 WP_000197208.1.24643 WP_000197208.1.24688 WP_000197208.1.24716 WP_000197208.1.2481 WP_000197208.1.24832 WP_000197208.1.24964 WP_000197208.1.25017 WP_000197208.1.25032 WP_000197208.1.25041 WP_000197208.1.25053 WP_000197208.1.25140 WP_000197208.1.25185 WP_000197208.1.25196 WP_000197208.1.25210 WP_000197208.1.25219 WP_000197208.1.25304 WP_000197208.1.25374 WP_000197208.1.25475 WP_000197208.1.25490 WP_000197208.1.25508 WP_000197208.1.25512 WP_000197208.1.25603 WP_000197208.1.2562 WP_000197208.1.25666 WP_000197208.1.25807 WP_000197208.1.25821 WP_000197208.1.25833 WP_000197208.1.25835 WP_000197208.1.25882 WP_000197208.1.25911 WP_000197208.1.25962 WP_000197208.1.25963 WP_000197208.1.26001 WP_000197208.1.26027 WP_000197208.1.26107 WP_000197208.1.2615 WP_000197208.1.26217 WP_000197208.1.26230 WP_000197208.1.26232 WP_000197208.1.26272 WP_000197208.1.26286 WP_000197208.1.26288 WP_000197208.1.26394 WP_000197208.1.26491 WP_000197208.1.2654 WP_000197208.1.26554 WP_000197208.1.26636 WP_000197208.1.26689 WP_000197208.1.2679 WP_000197208.1.26908 WP_000197208.1.2692 WP_000197208.1.26928 WP_000197208.1.270 WP_000197208.1.27008 WP_000197208.1.27027 WP_000197208.1.27070 WP_000197208.1.27077 WP_000197208.1.27086 WP_000197208.1.27087 WP_000197208.1.27111 WP_000197208.1.27115 WP_000197208.1.2713 WP_000197208.1.2717 WP_000197208.1.27228 WP_000197208.1.27282 WP_000197208.1.27285 WP_000197208.1.27309 WP_000197208.1.27329 WP_000197208.1.27361 WP_000197208.1.27565 WP_000197208.1.27595 WP_000197208.1.27598 WP_000197208.1.27706 WP_000197208.1.27775 WP_000197208.1.27785 WP_000197208.1.27900 WP_000197208.1.27928 WP_000197208.1.27945 WP_000197208.1.28004 WP_000197208.1.2809 WP_000197208.1.28155 WP_000197208.1.28198 WP_000197208.1.2822 WP_000197208.1.28229 WP_000197208.1.28384 WP_000197208.1.28386 WP_000197208.1.28395 WP_000197208.1.284 WP_000197208.1.2845 WP_000197208.1.28479 WP_000197208.1.28627 WP_000197208.1.28692 WP_000197208.1.2873 WP_000197208.1.28917 WP_000197208.1.28962 WP_000197208.1.29023 WP_000197208.1.29042 WP_000197208.1.2905 WP_000197208.1.2907 WP_000197208.1.29081 WP_000197208.1.29089 WP_000197208.1.29153 WP_000197208.1.29203 WP_000197208.1.29237 WP_000197208.1.29248 WP_000197208.1.29288 WP_000197208.1.29389 WP_000197208.1.29439 WP_000197208.1.2946 WP_000197208.1.29462 WP_000197208.1.29563 WP_000197208.1.29727 WP_000197208.1.29743 WP_000197208.1.29782 WP_000197208.1.29833 WP_000197208.1.29851 WP_000197208.1.29865 WP_000197208.1.29886 WP_000197208.1.29919 WP_000197208.1.2994 WP_000197208.1.29964 WP_000197208.1.29983 WP_000197208.1.30009 WP_000197208.1.30013 WP_000197208.1.3002 WP_000197208.1.30034 WP_000197208.1.30049 WP_000197208.1.30058 WP_000197208.1.30172 WP_000197208.1.30185 WP_000197208.1.30354 WP_000197208.1.30357 WP_000197208.1.30362 WP_000197208.1.3042 WP_000197208.1.30421 WP_000197208.1.30440 WP_000197208.1.30448 WP_000197208.1.30489 WP_000197208.1.30517 WP_000197208.1.30542 WP_000197208.1.30544 WP_000197208.1.30556 WP_000197208.1.30572 WP_000197208.1.30585 WP_000197208.1.30618 WP_000197208.1.30664 WP_000197208.1.30688 WP_000197208.1.30806 WP_000197208.1.30967 WP_000197208.1.31046 WP_000197208.1.31066 WP_000197208.1.31078 WP_000197208.1.31139 WP_000197208.1.31145 WP_000197208.1.31182 WP_000197208.1.31205 WP_000197208.1.3121 WP_000197208.1.31223 WP_000197208.1.31303 WP_000197208.1.3131 WP_000197208.1.31352 WP_000197208.1.31389 WP_000197208.1.31413 WP_000197208.1.31446 WP_000197208.1.31533 WP_000197208.1.31799 WP_000197208.1.31836 WP_000197208.1.31951 WP_000197208.1.32041 WP_000197208.1.32042 WP_000197208.1.3207 WP_000197208.1.32189 WP_000197208.1.32202 WP_000197208.1.32263 WP_000197208.1.32293 WP_000197208.1.32299 WP_000197208.1.32422 WP_000197208.1.32425 WP_000197208.1.32458 WP_000197208.1.32460 WP_000197208.1.32529 WP_000197208.1.32563 WP_000197208.1.32578 WP_000197208.1.32617 WP_000197208.1.3270 WP_000197208.1.32725 WP_000197208.1.32838 WP_000197208.1.32848 WP_000197208.1.32868 WP_000197208.1.3290 WP_000197208.1.32940 WP_000197208.1.32941 WP_000197208.1.3296 WP_000197208.1.32966 WP_000197208.1.32985 WP_000197208.1.33037 WP_000197208.1.3305 WP_000197208.1.33051 WP_000197208.1.33065 WP_000197208.1.33122 WP_000197208.1.3315 WP_000197208.1.33208 WP_000197208.1.33214 WP_000197208.1.33247 WP_000197208.1.33280 WP_000197208.1.33283 WP_000197208.1.33313 WP_000197208.1.33339 WP_000197208.1.33382 WP_000197208.1.33490 WP_000197208.1.33501 WP_000197208.1.33529 WP_000197208.1.33689 WP_000197208.1.3370 WP_000197208.1.33730 WP_000197208.1.33741 WP_000197208.1.33840 WP_000197208.1.3392 WP_000197208.1.33926 WP_000197208.1.33957 WP_000197208.1.33969 WP_000197208.1.34001 WP_000197208.1.34059 WP_000197208.1.34118 WP_000197208.1.34211 WP_000197208.1.34214 WP_000197208.1.34234 WP_000197208.1.34284 WP_000197208.1.34376 WP_000197208.1.34382 WP_000197208.1.34484 WP_000197208.1.34517 WP_000197208.1.34530 WP_000197208.1.34665 WP_000197208.1.34694 WP_000197208.1.34751 WP_000197208.1.34808 WP_000197208.1.34824 WP_000197208.1.34834 WP_000197208.1.34932 WP_000197208.1.34962 WP_000197208.1.35001 WP_000197208.1.35040 WP_000197208.1.35074 WP_000197208.1.35175 WP_000197208.1.35240 WP_000197208.1.35274 WP_000197208.1.35532 WP_000197208.1.35560 WP_000197208.1.3557 WP_000197208.1.35628 WP_000197208.1.3570 WP_000197208.1.35712 WP_000197208.1.35713 WP_000197208.1.35736 WP_000197208.1.35791 WP_000197208.1.35795 WP_000197208.1.35870 WP_000197208.1.35916 WP_000197208.1.35938 WP_000197208.1.35966 WP_000197208.1.36000 WP_000197208.1.36034 WP_000197208.1.36036 WP_000197208.1.36069 WP_000197208.1.36291 WP_000197208.1.36298 WP_000197208.1.36308 WP_000197208.1.36323 WP_000197208.1.36343 WP_000197208.1.36460 WP_000197208.1.3649 WP_000197208.1.36495 WP_000197208.1.36526 WP_000197208.1.36567 WP_000197208.1.36579 WP_000197208.1.36617 WP_000197208.1.36618 WP_000197208.1.36643 WP_000197208.1.36663 WP_000197208.1.36701 WP_000197208.1.36725 WP_000197208.1.36779 WP_000197208.1.36798 WP_000197208.1.36802 WP_000197208.1.36821 WP_000197208.1.36853 WP_000197208.1.36950 WP_000197208.1.37014 WP_000197208.1.37133 WP_000197208.1.37176 WP_000197208.1.37199 WP_000197208.1.37200 WP_000197208.1.37258 WP_000197208.1.37303 WP_000197208.1.37513 WP_000197208.1.37584 WP_000197208.1.37590 WP_000197208.1.37593 WP_000197208.1.37600 WP_000197208.1.37613 WP_000197208.1.37659 WP_000197208.1.37662 WP_000197208.1.37675 WP_000197208.1.37691 WP_000197208.1.37761 WP_000197208.1.37775 WP_000197208.1.37777 WP_000197208.1.378 WP_000197208.1.379 WP_000197208.1.37911 WP_000197208.1.37941 WP_000197208.1.37985 WP_000197208.1.38061 WP_000197208.1.38064 WP_000197208.1.38108 WP_000197208.1.3816 WP_000197208.1.38207 WP_000197208.1.38261 WP_000197208.1.38266 WP_000197208.1.38310 WP_000197208.1.3834 WP_000197208.1.38351 WP_000197208.1.3838 WP_000197208.1.38381 WP_000197208.1.38440 WP_000197208.1.38486 WP_000197208.1.38515 WP_000197208.1.38595 WP_000197208.1.3860 WP_000197208.1.38642 WP_000197208.1.38734 WP_000197208.1.38877 WP_000197208.1.38983 WP_000197208.1.38996 WP_000197208.1.39056 WP_000197208.1.3907 WP_000197208.1.39105 WP_000197208.1.3914 WP_000197208.1.39147 WP_000197208.1.39161 WP_000197208.1.39210 WP_000197208.1.39235 WP_000197208.1.3931 WP_000197208.1.39435 WP_000197208.1.39502 WP_000197208.1.39530 WP_000197208.1.39619 WP_000197208.1.39620 WP_000197208.1.39624 WP_000197208.1.39659 WP_000197208.1.39667 WP_000197208.1.39775 WP_000197208.1.39879 WP_000197208.1.39890 WP_000197208.1.39941 WP_000197208.1.39945 WP_000197208.1.39947 WP_000197208.1.40095 WP_000197208.1.40097 WP_000197208.1.401 WP_000197208.1.40160 WP_000197208.1.40167 WP_000197208.1.40279 WP_000197208.1.40361 WP_000197208.1.4042 WP_000197208.1.40467 WP_000197208.1.40496 WP_000197208.1.40517 WP_000197208.1.40698 WP_000197208.1.40750 WP_000197208.1.40763 WP_000197208.1.40854 WP_000197208.1.4089 WP_000197208.1.40924 WP_000197208.1.40932 WP_000197208.1.40946 WP_000197208.1.41004 WP_000197208.1.4106 WP_000197208.1.41070 WP_000197208.1.41074 WP_000197208.1.41075 WP_000197208.1.41097 WP_000197208.1.41132 WP_000197208.1.41176 WP_000197208.1.41251 WP_000197208.1.41258 WP_000197208.1.41305 WP_000197208.1.41321 WP_000197208.1.41333 WP_000197208.1.41335 WP_000197208.1.4136 WP_000197208.1.41415 WP_000197208.1.41459 WP_000197208.1.41498 WP_000197208.1.41519 WP_000197208.1.41524 WP_000197208.1.41631 WP_000197208.1.41658 WP_000197208.1.41659 WP_000197208.1.41716 WP_000197208.1.41746 WP_000197208.1.41824 WP_000197208.1.41825 WP_000197208.1.41836 WP_000197208.1.41894 WP_000197208.1.41919 WP_000197208.1.41929 WP_000197208.1.4194 WP_000197208.1.42069 WP_000197208.1.42081 WP_000197208.1.42090 WP_000197208.1.42111 WP_000197208.1.42187 WP_000197208.1.42200 WP_000197208.1.42219 WP_000197208.1.42257 WP_000197208.1.42261 WP_000197208.1.42349 WP_000197208.1.42364 WP_000197208.1.42371 WP_000197208.1.42379 WP_000197208.1.42391 WP_000197208.1.42399 WP_000197208.1.42539 WP_000197208.1.42603 WP_000197208.1.42650 WP_000197208.1.4267 WP_000197208.1.42701 WP_000197208.1.42805 WP_000197208.1.42815 WP_000197208.1.42859 WP_000197208.1.4298 WP_000197208.1.43008 WP_000197208.1.43016 WP_000197208.1.43019 WP_000197208.1.43065 WP_000197208.1.43068 WP_000197208.1.43069 WP_000197208.1.43128 WP_000197208.1.43141 WP_000197208.1.43157 WP_000197208.1.43161 WP_000197208.1.43190 WP_000197208.1.43198 WP_000197208.1.4326 WP_000197208.1.43290 WP_000197208.1.43292 WP_000197208.1.43307 WP_000197208.1.43513 WP_000197208.1.43633 WP_000197208.1.43637 WP_000197208.1.43651 WP_000197208.1.43722 WP_000197208.1.43801 WP_000197208.1.43812 WP_000197208.1.43878 WP_000197208.1.43888 WP_000197208.1.43919 WP_000197208.1.43974 WP_000197208.1.44049 WP_000197208.1.44101 WP_000197208.1.44160 WP_000197208.1.44180 WP_000197208.1.44196 WP_000197208.1.44248 WP_000197208.1.44262 WP_000197208.1.44268 WP_000197208.1.4427 WP_000197208.1.44296 WP_000197208.1.44343 WP_000197208.1.44351 WP_000197208.1.44360 WP_000197208.1.44416 WP_000197208.1.44431 WP_000197208.1.44437 WP_000197208.1.44546 WP_000197208.1.4468 WP_000197208.1.44762 WP_000197208.1.44815 WP_000197208.1.44828 WP_000197208.1.44879 WP_000197208.1.44917 WP_000197208.1.4501 WP_000197208.1.45072 WP_000197208.1.45093 WP_000197208.1.45136 WP_000197208.1.45241 WP_000197208.1.45435 WP_000197208.1.45523 WP_000197208.1.45596 WP_000197208.1.45648 WP_000197208.1.45829 WP_000197208.1.45871 WP_000197208.1.46030 WP_000197208.1.46077 WP_000197208.1.46169 WP_000197208.1.46225 WP_000197208.1.46241 WP_000197208.1.46307 WP_000197208.1.46355 WP_000197208.1.464 WP_000197208.1.46454 WP_000197208.1.46461 WP_000197208.1.46504 WP_000197208.1.46505 WP_000197208.1.46551 WP_000197208.1.46559 WP_000197208.1.46701 WP_000197208.1.46781 WP_000197208.1.46816 WP_000197208.1.46842 WP_000197208.1.4690 WP_000197208.1.46920 WP_000197208.1.46945 WP_000197208.1.47036 WP_000197208.1.47042 WP_000197208.1.47059 WP_000197208.1.47085 WP_000197208.1.47123 WP_000197208.1.47215 WP_000197208.1.47245 WP_000197208.1.47523 WP_000197208.1.47531 WP_000197208.1.47532 WP_000197208.1.47605 WP_000197208.1.47630 WP_000197208.1.4774 WP_000197208.1.47756 WP_000197208.1.4781 WP_000197208.1.47886 WP_000197208.1.47898 WP_000197208.1.48019 WP_000197208.1.48100 WP_000197208.1.48114 WP_000197208.1.48139 WP_000197208.1.48190 WP_000197208.1.48292 WP_000197208.1.48324 WP_000197208.1.48426 WP_000197208.1.48430 WP_000197208.1.48436 WP_000197208.1.48586 WP_000197208.1.4859 WP_000197208.1.48591 WP_000197208.1.48610 WP_000197208.1.48631 WP_000197208.1.48663 WP_000197208.1.48690 WP_000197208.1.48734 WP_000197208.1.48756 WP_000197208.1.48778 WP_000197208.1.48849 WP_000197208.1.48955 WP_000197208.1.48963 WP_000197208.1.48973 WP_000197208.1.49004 WP_000197208.1.49106 WP_000197208.1.49117 WP_000197208.1.49121 WP_000197208.1.4914 WP_000197208.1.49140 WP_000197208.1.49153 WP_000197208.1.49166 WP_000197208.1.49355 WP_000197208.1.49429 WP_000197208.1.49434 WP_000197208.1.49450 WP_000197208.1.495 WP_000197208.1.49545 WP_000197208.1.49703 WP_000197208.1.49769 WP_000197208.1.49846 WP_000197208.1.4991 WP_000197208.1.49947 WP_000197208.1.49959 WP_000197208.1.49997 WP_000197208.1.50014 WP_000197208.1.50030 WP_000197208.1.50043 WP_000197208.1.50103 WP_000197208.1.50158 WP_000197208.1.50247 WP_000197208.1.50308 WP_000197208.1.50309 WP_000197208.1.50387 WP_000197208.1.50406 WP_000197208.1.50468 WP_000197208.1.5051 WP_000197208.1.50566 WP_000197208.1.50570 WP_000197208.1.50626 WP_000197208.1.50726 WP_000197208.1.50771 WP_000197208.1.50875 WP_000197208.1.50885 WP_000197208.1.509 WP_000197208.1.50929 WP_000197208.1.50970 WP_000197208.1.51040 WP_000197208.1.51048 WP_000197208.1.51100 WP_000197208.1.51134 WP_000197208.1.51227 WP_000197208.1.5127 WP_000197208.1.51305 WP_000197208.1.51315 WP_000197208.1.5136 WP_000197208.1.51474 WP_000197208.1.51519 WP_000197208.1.51598 WP_000197208.1.51644 WP_000197208.1.51724 WP_000197208.1.51734 WP_000197208.1.51838 WP_000197208.1.51863 WP_000197208.1.51935 WP_000197208.1.52057 WP_000197208.1.52114 WP_000197208.1.52129 WP_000197208.1.52191 WP_000197208.1.52202 WP_000197208.1.52209 WP_000197208.1.52339 WP_000197208.1.52469 WP_000197208.1.52571 WP_000197208.1.526 WP_000197208.1.52647 WP_000197208.1.52742 WP_000197208.1.52773 WP_000197208.1.52795 WP_000197208.1.52807 WP_000197208.1.52887 WP_000197208.1.53092 WP_000197208.1.53141 WP_000197208.1.53151 WP_000197208.1.53154 WP_000197208.1.53159 WP_000197208.1.53210 WP_000197208.1.53233 WP_000197208.1.53307 WP_000197208.1.53321 WP_000197208.1.53368 WP_000197208.1.53375 WP_000197208.1.53450 WP_000197208.1.5349 WP_000197208.1.53540 WP_000197208.1.53555 WP_000197208.1.53559 WP_000197208.1.5356 WP_000197208.1.53571 WP_000197208.1.5358 WP_000197208.1.53692 WP_000197208.1.53723 WP_000197208.1.5374 WP_000197208.1.53750 WP_000197208.1.53800 WP_000197208.1.53815 WP_000197208.1.53839 WP_000197208.1.53892 WP_000197208.1.53898 WP_000197208.1.53902 WP_000197208.1.53958 WP_000197208.1.53981 WP_000197208.1.53984 WP_000197208.1.54132 WP_000197208.1.54170 WP_000197208.1.54175 WP_000197208.1.54203 WP_000197208.1.54259 WP_000197208.1.5430 WP_000197208.1.54371 WP_000197208.1.54431 WP_000197208.1.54442 WP_000197208.1.54482 WP_000197208.1.54589 WP_000197208.1.54667 WP_000197208.1.54678 WP_000197208.1.54681 WP_000197208.1.54748 WP_000197208.1.5481 WP_000197208.1.54865 WP_000197208.1.54935 WP_000197208.1.54979 WP_000197208.1.55010 WP_000197208.1.55034 WP_000197208.1.55163 WP_000197208.1.55165 WP_000197208.1.55215 WP_000197208.1.55290 WP_000197208.1.55310 WP_000197208.1.55317 WP_000197208.1.55379 WP_000197208.1.5539 WP_000197208.1.55468 WP_000197208.1.55506 WP_000197208.1.55604 WP_000197208.1.55639 WP_000197208.1.55699 WP_000197208.1.55725 WP_000197208.1.55780 WP_000197208.1.55967 WP_000197208.1.56144 WP_000197208.1.56172 WP_000197208.1.5621 WP_000197208.1.56226 WP_000197208.1.56311 WP_000197208.1.56419 WP_000197208.1.56423 WP_000197208.1.56514 WP_000197208.1.56535 WP_000197208.1.56585 WP_000197208.1.56640 WP_000197208.1.56724 WP_000197208.1.56825 WP_000197208.1.56887 WP_000197208.1.56889 WP_000197208.1.56981 WP_000197208.1.57101 WP_000197208.1.57137 WP_000197208.1.57147 WP_000197208.1.57179 WP_000197208.1.57186 WP_000197208.1.57342 WP_000197208.1.57684 WP_000197208.1.57699 WP_000197208.1.57785 WP_000197208.1.57800 WP_000197208.1.57873 WP_000197208.1.57965 WP_000197208.1.57972 WP_000197208.1.58008 WP_000197208.1.58044 WP_000197208.1.58081 WP_000197208.1.5809 WP_000197208.1.58132 WP_000197208.1.58173 WP_000197208.1.58191 WP_000197208.1.58194 WP_000197208.1.58252 WP_000197208.1.58261 WP_000197208.1.58274 WP_000197208.1.58282 WP_000197208.1.58324 WP_000197208.1.58326 WP_000197208.1.5836 WP_000197208.1.58485 WP_000197208.1.58537 WP_000197208.1.58568 WP_000197208.1.58583 WP_000197208.1.58652 WP_000197208.1.58663 WP_000197208.1.58724 WP_000197208.1.5875 WP_000197208.1.58796 WP_000197208.1.58807 WP_000197208.1.58847 WP_000197208.1.58883 WP_000197208.1.58898 WP_000197208.1.58949 WP_000197208.1.58963 WP_000197208.1.58970 WP_000197208.1.58974 WP_000197208.1.59020 WP_000197208.1.59043 WP_000197208.1.59056 WP_000197208.1.59061 WP_000197208.1.59064 WP_000197208.1.59282 WP_000197208.1.59299 WP_000197208.1.59313 WP_000197208.1.5949 WP_000197208.1.59501 WP_000197208.1.59510 WP_000197208.1.5969 WP_000197208.1.59751 WP_000197208.1.59827 WP_000197208.1.59829 WP_000197208.1.59847 WP_000197208.1.59863 WP_000197208.1.59969 WP_000197208.1.59994 WP_000197208.1.60045 WP_000197208.1.60076 WP_000197208.1.60114 WP_000197208.1.60154 WP_000197208.1.60168 WP_000197208.1.60192 WP_000197208.1.60199 WP_000197208.1.60212 WP_000197208.1.60253 WP_000197208.1.60322 WP_000197208.1.60324 WP_000197208.1.60356 WP_000197208.1.6038 WP_000197208.1.60380 WP_000197208.1.6041 WP_000197208.1.60424 WP_000197208.1.60481 WP_000197208.1.605 WP_000197208.1.6058 WP_000197208.1.60584 WP_000197208.1.6060 WP_000197208.1.60676 WP_000197208.1.60708 WP_000197208.1.60725 WP_000197208.1.60783 WP_000197208.1.60792 WP_000197208.1.60807 WP_000197208.1.60882 WP_000197208.1.60889 WP_000197208.1.60950 WP_000197208.1.6104 WP_000197208.1.61044 WP_000197208.1.61076 WP_000197208.1.61123 WP_000197208.1.61147 WP_000197208.1.61168 WP_000197208.1.61210 WP_000197208.1.61357 WP_000197208.1.61511 WP_000197208.1.61539 WP_000197208.1.61542 WP_000197208.1.61553 WP_000197208.1.61649 WP_000197208.1.61652 WP_000197208.1.61697 WP_000197208.1.61809 WP_000197208.1.61877 WP_000197208.1.61920 WP_000197208.1.62124 WP_000197208.1.62199 WP_000197208.1.62223 WP_000197208.1.62302 WP_000197208.1.62314 WP_000197208.1.62323 WP_000197208.1.62333 WP_000197208.1.62338 WP_000197208.1.62380 WP_000197208.1.62411 WP_000197208.1.62436 WP_000197208.1.62475 WP_000197208.1.62536 WP_000197208.1.62640 WP_000197208.1.62686 WP_000197208.1.62751 WP_000197208.1.62825 WP_000197208.1.62913 WP_000197208.1.62932 WP_000197208.1.62960 WP_000197208.1.63016 WP_000197208.1.63025 WP_000197208.1.63069 WP_000197208.1.63087 WP_000197208.1.63169 WP_000197208.1.63297 WP_000197208.1.63448 WP_000197208.1.63514 WP_000197208.1.63583 WP_000197208.1.63592 WP_000197208.1.63663 WP_000197208.1.63736 WP_000197208.1.63816 WP_000197208.1.63876 WP_000197208.1.6389 WP_000197208.1.63901 WP_000197208.1.63955 WP_000197208.1.63963 WP_000197208.1.64032 WP_000197208.1.64087 WP_000197208.1.6415 WP_000197208.1.64293 WP_000197208.1.64332 WP_000197208.1.64376 WP_000197208.1.644 WP_000197208.1.64471 WP_000197208.1.64538 WP_000197208.1.64632 WP_000197208.1.64648 WP_000197208.1.64654 WP_000197208.1.64662 WP_000197208.1.64663 WP_000197208.1.64709 WP_000197208.1.64710 WP_000197208.1.64744 WP_000197208.1.64763 WP_000197208.1.64817 WP_000197208.1.64847 WP_000197208.1.6487 WP_000197208.1.64891 WP_000197208.1.64974 WP_000197208.1.65054 WP_000197208.1.65075 WP_000197208.1.6514 WP_000197208.1.65172 WP_000197208.1.65191 WP_000197208.1.65200 WP_000197208.1.65211 WP_000197208.1.65218 WP_000197208.1.65226 WP_000197208.1.65249 WP_000197208.1.65266 WP_000197208.1.65395 WP_000197208.1.65459 WP_000197208.1.65463 WP_000197208.1.65487 WP_000197208.1.6549 WP_000197208.1.65499 WP_000197208.1.6554 WP_000197208.1.65650 WP_000197208.1.65697 WP_000197208.1.65699 WP_000197208.1.65737 WP_000197208.1.65755 WP_000197208.1.65812 WP_000197208.1.65846 WP_000197208.1.65863 WP_000197208.1.65985 WP_000197208.1.66021 WP_000197208.1.66031 WP_000197208.1.66052 WP_000197208.1.66064 WP_000197208.1.66109 WP_000197208.1.66145 WP_000197208.1.66183 WP_000197208.1.6620 WP_000197208.1.66216 WP_000197208.1.66234 WP_000197208.1.66273 WP_000197208.1.66324 WP_000197208.1.6634 WP_000197208.1.66361 WP_000197208.1.66480 WP_000197208.1.66506 WP_000197208.1.66665 WP_000197208.1.66681 WP_000197208.1.66684 WP_000197208.1.66755 WP_000197208.1.66759 WP_000197208.1.66801 WP_000197208.1.66860 WP_000197208.1.66953 WP_000197208.1.66955 WP_000197208.1.66981 WP_000197208.1.67024 WP_000197208.1.67042 WP_000197208.1.67101 WP_000197208.1.67143 WP_000197208.1.67201 WP_000197208.1.67211 WP_000197208.1.67237 WP_000197208.1.67336 WP_000197208.1.67339 WP_000197208.1.67387 WP_000197208.1.67394 WP_000197208.1.67397 WP_000197208.1.67403 WP_000197208.1.67430 WP_000197208.1.67442 WP_000197208.1.67539 WP_000197208.1.67556 WP_000197208.1.67604 WP_000197208.1.67619 WP_000197208.1.67625 WP_000197208.1.67627 WP_000197208.1.67641 WP_000197208.1.67657 WP_000197208.1.67673 WP_000197208.1.67700 WP_000197208.1.67718 WP_000197208.1.67729 WP_000197208.1.67774 WP_000197208.1.67820 WP_000197208.1.67910 WP_000197208.1.67954 WP_000197208.1.68 WP_000197208.1.68043 WP_000197208.1.68105 WP_000197208.1.68113 WP_000197208.1.68131 WP_000197208.1.68182 WP_000197208.1.6819 WP_000197208.1.68285 WP_000197208.1.68359 WP_000197208.1.68420 WP_000197208.1.68514 WP_000197208.1.68564 WP_000197208.1.68688 WP_000197208.1.68742 WP_000197208.1.68770 WP_000197208.1.68809 WP_000197208.1.68914 WP_000197208.1.69053 WP_000197208.1.69170 WP_000197208.1.69210 WP_000197208.1.69270 WP_000197208.1.69282 WP_000197208.1.69376 WP_000197208.1.69396 WP_000197208.1.69466 WP_000197208.1.69611 WP_000197208.1.69642 WP_000197208.1.69656 WP_000197208.1.69657 WP_000197208.1.69690 WP_000197208.1.69923 WP_000197208.1.69948 WP_000197208.1.69953 WP_000197208.1.70010 WP_000197208.1.70049 WP_000197208.1.70058 WP_000197208.1.70061 WP_000197208.1.70205 WP_000197208.1.70240 WP_000197208.1.70249 WP_000197208.1.70261 WP_000197208.1.70314 WP_000197208.1.7033 WP_000197208.1.70427 WP_000197208.1.70433 WP_000197208.1.70545 WP_000197208.1.70623 WP_000197208.1.70671 WP_000197208.1.70679 WP_000197208.1.70708 WP_000197208.1.70717 WP_000197208.1.70731 WP_000197208.1.70772 WP_000197208.1.70845 WP_000197208.1.70846 WP_000197208.1.70981 WP_000197208.1.70995 WP_000197208.1.71039 WP_000197208.1.71057 WP_000197208.1.71081 WP_000197208.1.71117 WP_000197208.1.71186 WP_000197208.1.71455 WP_000197208.1.71456 WP_000197208.1.71487 WP_000197208.1.71523 WP_000197208.1.71542 WP_000197208.1.71566 WP_000197208.1.71640 WP_000197208.1.71651 WP_000197208.1.71653 WP_000197208.1.71716 WP_000197208.1.71872 WP_000197208.1.71950 WP_000197208.1.71954 WP_000197208.1.71985 WP_000197208.1.72003 WP_000197208.1.72073 WP_000197208.1.72269 WP_000197208.1.72350 WP_000197208.1.72383 WP_000197208.1.72461 WP_000197208.1.72527 WP_000197208.1.7255 WP_000197208.1.72631 WP_000197208.1.72638 WP_000197208.1.72667 WP_000197208.1.72674 WP_000197208.1.72724 WP_000197208.1.72789 WP_000197208.1.72828 WP_000197208.1.72896 WP_000197208.1.72969 WP_000197208.1.72987 WP_000197208.1.73052 WP_000197208.1.7311 WP_000197208.1.73114 WP_000197208.1.73177 WP_000197208.1.73180 WP_000197208.1.73258 WP_000197208.1.73285 WP_000197208.1.7332 WP_000197208.1.7333 WP_000197208.1.73352 WP_000197208.1.73389 WP_000197208.1.73425 WP_000197208.1.73488 WP_000197208.1.73504 WP_000197208.1.7353 WP_000197208.1.73544 WP_000197208.1.73598 WP_000197208.1.7361 WP_000197208.1.73648 WP_000197208.1.73849 WP_000197208.1.73948 WP_000197208.1.73999 WP_000197208.1.74024 WP_000197208.1.74030 WP_000197208.1.74038 WP_000197208.1.74043 WP_000197208.1.74058 WP_000197208.1.74070 WP_000197208.1.74077 WP_000197208.1.74135 WP_000197208.1.74214 WP_000197208.1.74241 WP_000197208.1.74285 WP_000197208.1.7430 WP_000197208.1.74317 WP_000197208.1.74415 WP_000197208.1.74616 WP_000197208.1.74621 WP_000197208.1.74647 WP_000197208.1.74677 WP_000197208.1.74699 WP_000197208.1.74831 WP_000197208.1.74894 WP_000197208.1.74929 WP_000197208.1.74939 WP_000197208.1.74973 WP_000197208.1.7507 WP_000197208.1.75089 WP_000197208.1.75116 WP_000197208.1.75237 WP_000197208.1.75273 WP_000197208.1.75296 WP_000197208.1.75413 WP_000197208.1.75433 WP_000197208.1.75532 WP_000197208.1.75565 WP_000197208.1.75593 WP_000197208.1.75610 WP_000197208.1.75633 WP_000197208.1.75718 WP_000197208.1.75745 WP_000197208.1.75844 WP_000197208.1.75886 WP_000197208.1.75898 WP_000197208.1.76081 WP_000197208.1.76116 WP_000197208.1.76122 WP_000197208.1.76256 WP_000197208.1.76339 WP_000197208.1.76366 WP_000197208.1.76417 WP_000197208.1.7646 WP_000197208.1.76510 WP_000197208.1.76558 WP_000197208.1.76572 WP_000197208.1.76641 WP_000197208.1.76651 WP_000197208.1.76653 WP_000197208.1.76788 WP_000197208.1.76854 WP_000197208.1.76916 WP_000197208.1.76932 WP_000197208.1.76973 WP_000197208.1.76988 WP_000197208.1.77016 WP_000197208.1.77087 WP_000197208.1.77090 WP_000197208.1.77111 WP_000197208.1.77299 WP_000197208.1.77384 WP_000197208.1.77501 WP_000197208.1.77512 WP_000197208.1.77513 WP_000197208.1.77563 WP_000197208.1.77702 WP_000197208.1.77713 WP_000197208.1.7772 WP_000197208.1.77825 WP_000197208.1.77837 WP_000197208.1.77900 WP_000197208.1.77923 WP_000197208.1.77975 WP_000197208.1.78035 WP_000197208.1.78048 WP_000197208.1.78107 WP_000197208.1.78166 WP_000197208.1.78192 WP_000197208.1.78195 WP_000197208.1.78291 WP_000197208.1.78309 WP_000197208.1.78320 WP_000197208.1.78382 WP_000197208.1.78388 WP_000197208.1.78410 WP_000197208.1.7862 WP_000197208.1.78626 WP_000197208.1.78661 WP_000197208.1.78674 WP_000197208.1.78676 WP_000197208.1.78761 WP_000197208.1.789 WP_000197208.1.78993 WP_000197208.1.79012 WP_000197208.1.79069 WP_000197208.1.79074 WP_000197208.1.79098 WP_000197208.1.79155 WP_000197208.1.79164 WP_000197208.1.79204 WP_000197208.1.79280 WP_000197208.1.79397 WP_000197208.1.79456 WP_000197208.1.79532 WP_000197208.1.79547 WP_000197208.1.79654 WP_000197208.1.7970 WP_000197208.1.79722 WP_000197208.1.79772 WP_000197208.1.79880 WP_000197208.1.79916 WP_000197208.1.80065 WP_000197208.1.80103 WP_000197208.1.80273 WP_000197208.1.80282 WP_000197208.1.80354 WP_000197208.1.80368 WP_000197208.1.80386 WP_000197208.1.80400 WP_000197208.1.80462 WP_000197208.1.8049 WP_000197208.1.80492 WP_000197208.1.80569 WP_000197208.1.80664 WP_000197208.1.80696 WP_000197208.1.80984 WP_000197208.1.81131 WP_000197208.1.81187 WP_000197208.1.81262 WP_000197208.1.81268 WP_000197208.1.81269 WP_000197208.1.81271 WP_000197208.1.8131 WP_000197208.1.81333 WP_000197208.1.81342 WP_000197208.1.81364 WP_000197208.1.81494 WP_000197208.1.81557 WP_000197208.1.81676 WP_000197208.1.81681 WP_000197208.1.8170 WP_000197208.1.81763 WP_000197208.1.81855 WP_000197208.1.81921 WP_000197208.1.81931 WP_000197208.1.81936 WP_000197208.1.81949 WP_000197208.1.82070 WP_000197208.1.82076 WP_000197208.1.82131 WP_000197208.1.82156 WP_000197208.1.8218 WP_000197208.1.82180 WP_000197208.1.82201 WP_000197208.1.82214 WP_000197208.1.82225 WP_000197208.1.8240 WP_000197208.1.82408 WP_000197208.1.82416 WP_000197208.1.8242 WP_000197208.1.82456 WP_000197208.1.82465 WP_000197208.1.82473 WP_000197208.1.82553 WP_000197208.1.82646 WP_000197208.1.82670 WP_000197208.1.82731 WP_000197208.1.82812 WP_000197208.1.82850 WP_000197208.1.82872 WP_000197208.1.8294 WP_000197208.1.82959 WP_000197208.1.83007 WP_000197208.1.8304 WP_000197208.1.83180 WP_000197208.1.83229 WP_000197208.1.83235 WP_000197208.1.83290 WP_000197208.1.83333 WP_000197208.1.83657 WP_000197208.1.83677 WP_000197208.1.8375 WP_000197208.1.83923 WP_000197208.1.83994 WP_000197208.1.84 WP_000197208.1.8406 WP_000197208.1.84076 WP_000197208.1.84110 WP_000197208.1.84127 WP_000197208.1.84150 WP_000197208.1.84230 WP_000197208.1.84252 WP_000197208.1.8431 WP_000197208.1.84345 WP_000197208.1.84369 WP_000197208.1.84401 WP_000197208.1.84435 WP_000197208.1.84567 WP_000197208.1.84631 WP_000197208.1.84727 WP_000197208.1.84744 WP_000197208.1.84773 WP_000197208.1.84945 WP_000197208.1.84967 WP_000197208.1.85004 WP_000197208.1.8502 WP_000197208.1.85039 WP_000197208.1.85153 WP_000197208.1.85273 WP_000197208.1.85338 WP_000197208.1.85339 WP_000197208.1.85511 WP_000197208.1.85512 WP_000197208.1.8557 WP_000197208.1.85606 WP_000197208.1.85635 WP_000197208.1.85646 WP_000197208.1.85665 WP_000197208.1.85669 WP_000197208.1.85688 WP_000197208.1.85703 WP_000197208.1.85728 WP_000197208.1.85746 WP_000197208.1.85811 WP_000197208.1.859 WP_000197208.1.85917 WP_000197208.1.8594 WP_000197208.1.85977 WP_000197208.1.860 WP_000197208.1.8605 WP_000197208.1.86084 WP_000197208.1.8610 WP_000197208.1.8614 WP_000197208.1.86156 WP_000197208.1.86323 WP_000197208.1.86342 WP_000197208.1.8640 WP_000197208.1.8642 WP_000197208.1.86426 WP_000197208.1.86489 WP_000197208.1.86530 WP_000197208.1.86663 WP_000197208.1.86770 WP_000197208.1.86794 WP_000197208.1.86800 WP_000197208.1.86811 WP_000197208.1.86815 WP_000197208.1.86945 WP_000197208.1.86989 WP_000197208.1.87023 WP_000197208.1.87034 WP_000197208.1.87041 WP_000197208.1.87136 WP_000197208.1.87155 WP_000197208.1.87258 WP_000197208.1.87293 WP_000197208.1.87420 WP_000197208.1.87528 WP_000197208.1.87560 WP_000197208.1.8760 WP_000197208.1.87600 WP_000197208.1.87609 WP_000197208.1.87612 WP_000197208.1.87615 WP_000197208.1.87653 WP_000197208.1.87659 WP_000197208.1.87698 WP_000197208.1.87706 WP_000197208.1.87739 WP_000197208.1.87741 WP_000197208.1.87742 WP_000197208.1.87852 WP_000197208.1.87949 WP_000197208.1.88025 WP_000197208.1.88026 WP_000197208.1.8805 WP_000197208.1.8806 WP_000197208.1.881 WP_000197208.1.88145 WP_000197208.1.88199 WP_000197208.1.88299 WP_000197208.1.88313 WP_000197208.1.88359 WP_000197208.1.88407 WP_000197208.1.88414 WP_000197208.1.88444 WP_000197208.1.88446 WP_000197208.1.88458 WP_000197208.1.88501 WP_000197208.1.88538 WP_000197208.1.88547 WP_000197208.1.886 WP_000197208.1.88647 WP_000197208.1.88648 WP_000197208.1.88692 WP_000197208.1.88707 WP_000197208.1.88727 WP_000197208.1.88772 WP_000197208.1.88850 WP_000197208.1.8889 WP_000197208.1.88892 WP_000197208.1.88894 WP_000197208.1.89182 WP_000197208.1.89298 WP_000197208.1.89308 WP_000197208.1.89314 WP_000197208.1.89328 WP_000197208.1.89332 WP_000197208.1.89343 WP_000197208.1.89395 WP_000197208.1.8940 WP_000197208.1.89449 WP_000197208.1.8947 WP_000197208.1.89503 WP_000197208.1.89591 WP_000197208.1.89612 WP_000197208.1.89668 WP_000197208.1.89706 WP_000197208.1.89713 WP_000197208.1.89733 WP_000197208.1.89796 WP_000197208.1.89804 WP_000197208.1.89845 WP_000197208.1.89888 WP_000197208.1.89911 WP_000197208.1.8995 WP_000197208.1.89952 WP_000197208.1.90007 WP_000197208.1.9011 WP_000197208.1.90196 WP_000197208.1.90240 WP_000197208.1.90274 WP_000197208.1.90280 WP_000197208.1.90330 WP_000197208.1.90338 WP_000197208.1.90365 WP_000197208.1.90428 WP_000197208.1.90489 WP_000197208.1.90513 WP_000197208.1.90582 WP_000197208.1.90713 WP_000197208.1.90794 WP_000197208.1.90796 WP_000197208.1.90811 WP_000197208.1.9091 WP_000197208.1.91067 WP_000197208.1.91164 WP_000197208.1.91205 WP_000197208.1.91239 WP_000197208.1.91291 WP_000197208.1.91313 WP_000197208.1.9135 WP_000197208.1.91506 WP_000197208.1.91557 WP_000197208.1.91597 WP_000197208.1.91715 WP_000197208.1.9187 WP_000197208.1.91870 WP_000197208.1.92018 WP_000197208.1.92087 WP_000197208.1.92098 WP_000197208.1.92156 WP_000197208.1.92172 WP_000197208.1.92240 WP_000197208.1.92243 WP_000197208.1.92327 WP_000197208.1.92470 WP_000197208.1.92477 WP_000197208.1.92545 WP_000197208.1.92570 WP_000197208.1.92588 WP_000197208.1.926 WP_000197208.1.92633 WP_000197208.1.92649 WP_000197208.1.92676 WP_000197208.1.92705 WP_000197208.1.9271 WP_000197208.1.92734 WP_000197208.1.92810 WP_000197208.1.92823 WP_000197208.1.92987 WP_000197208.1.93007 WP_000197208.1.93022 WP_000197208.1.93103 WP_000197208.1.93105 WP_000197208.1.93111 WP_000197208.1.93121 WP_000197208.1.93168 WP_000197208.1.93184 WP_000197208.1.93221 WP_000197208.1.93223 WP_000197208.1.93239 WP_000197208.1.93302 WP_000197208.1.9336 WP_000197208.1.93387 WP_000197208.1.93469 WP_000197208.1.93511 WP_000197208.1.93512 WP_000197208.1.93635 WP_000197208.1.93657 WP_000197208.1.9374 WP_000197208.1.9375 WP_000197208.1.93754 WP_000197208.1.93780 WP_000197208.1.93828 WP_000197208.1.93842 WP_000197208.1.93843 WP_000197208.1.93875 WP_000197208.1.93909 WP_000197208.1.93919 WP_000197208.1.93938 WP_000197208.1.93984 WP_000197208.1.9399 WP_000197208.1.94017 WP_000197208.1.94079 WP_000197208.1.94097 WP_000197208.1.94107 WP_000197208.1.94142 WP_000197208.1.94215 WP_000197208.1.94303 WP_000197208.1.94365 WP_000197208.1.94390 WP_000197208.1.94415 WP_000197208.1.94492 WP_000197208.1.94510 WP_000197208.1.94527 WP_000197208.1.94573 WP_000197208.1.94579 WP_000197208.1.94586 WP_000197208.1.94593 WP_000197208.1.94650 WP_000197208.1.94659 WP_000197208.1.94662 WP_000197208.1.94700 WP_000197208.1.94745 WP_000197208.1.94782 WP_000197208.1.94815 WP_000197208.1.94820 WP_000197208.1.94850 WP_000197208.1.94851 WP_000197208.1.94864 WP_000197208.1.94952 WP_000197208.1.95006 WP_000197208.1.95055 WP_000197208.1.95076 WP_000197208.1.95099 WP_000197208.1.95165 WP_000197208.1.95239 WP_000197208.1.95246 WP_000197208.1.9525 WP_000197208.1.95255 WP_000197208.1.95265 WP_000197208.1.95338 WP_000197208.1.95412 WP_000197208.1.95530 WP_000197208.1.95547 WP_000197208.1.95590 WP_000197208.1.95625 WP_000197208.1.95675 WP_000197208.1.95716 WP_000197208.1.95776 WP_000197208.1.95884 WP_000197208.1.95890 WP_000197208.1.95906 WP_000197208.1.96025 WP_000197208.1.96044 WP_000197208.1.96054 WP_000197208.1.96094 WP_000197208.1.96127 WP_000197208.1.96144 WP_000197208.1.96188 WP_000197208.1.96211 WP_000197208.1.96212 WP_000197208.1.96319 WP_000197208.1.9633 WP_000197208.1.96359 WP_000197208.1.96539 WP_000197208.1.96552 WP_000197208.1.96610 WP_000197208.1.96625 WP_000197208.1.96635 WP_000197208.1.9664 WP_000197208.1.96675 WP_000197208.1.9670 WP_000197208.1.96750 WP_000197208.1.96792 WP_000197208.1.96801 WP_000197208.1.96803 WP_000197208.1.96925 WP_000197208.1.96938 WP_000197208.1.96946 WP_000197208.1.96957 WP_000197208.1.96978 WP_000197208.1.97026 WP_000197208.1.97028 WP_000197208.1.97079 WP_000197208.1.97154 WP_000197208.1.97184 WP_000197208.1.97287 WP_000197208.1.97291 WP_000197208.1.97422 WP_000197208.1.97441 WP_000197208.1.97497 WP_000197208.1.97505 WP_000197208.1.97599 WP_000197208.1.97606 WP_000197208.1.97615 WP_000197208.1.97646 WP_000197208.1.97690 WP_000197208.1.97819 WP_000197208.1.97840 WP_000197208.1.97938 WP_000197208.1.97986 WP_000197208.1.98036 WP_000197208.1.98080 WP_000197208.1.98086 WP_000197208.1.98158 WP_000197208.1.98263 WP_000197208.1.98418 WP_000197208.1.98448 WP_000197208.1.98457 WP_000197208.1.9850 WP_000197208.1.98502 WP_000197208.1.98607 WP_000197208.1.98731 WP_000197208.1.98762 WP_000197208.1.9877 WP_000197208.1.98801 WP_000197208.1.98818 WP_000197208.1.99163 WP_000197208.1.99335 WP_000197208.1.99350 WP_000197208.1.99360 WP_000197208.1.99363 WP_000197208.1.99369 WP_000197208.1.99388 WP_000197208.1.99397 WP_000197208.1.99463 WP_000197208.1.99483 WP_000197208.1.99546 WP_000197208.1.99579 WP_000197208.1.99595 WP_000197208.1.99671 WP_000197208.1.99676 WP_000197208.1.99764 WP_000197208.1.99829 WP_000197208.1.99837 WP_000197208.1.99841 WP_000197208.1.9992 WP_000197208.1.99996 AE014613|CDS_3621362-3620202 AL513382|CDS_3635702-3634542 209261.t3518 220341.STY3769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]