SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16762549|ref|NP_458166.1| from Salmonella enterica subsp. enterica serovar Typhi str. CT18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16762549|ref|NP_458166.1|
Domain Number 1 Region: 12-365
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.41e-31
Family AAT-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16762549|ref|NP_458166.1|
Sequence length 369
Comment transferase [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
Sequence
MTPNIYQQLGLKKVINACGKMTILGVSSVAPEVMQATARAASAFVEIDALVEKTGELVSR
YTGAEDSYITSCASAGIAIAVAAAITHGDRARVALMPDSTGMANEVVMLRGHNVDYGAPV
TSAIRLGGGRIVEVGSSNLAARWQLESAINEKTAALLYVKSHHCVQKGMLSIDDFVQVAQ
ANHLPLIVDAAAEEDLRGWVVSGADMVIYSGAKAFNAPTSGFITGKKTWIAACKAQHQGI
ARAMKIGKENMVGLVYALENYHQGQTTVTAAQLQPVAEAISAIHGLYADIEQDEAGRAIW
RIRVRVNASELGLNAQDVEAQLRGGEIAIYARKYQLHQGVFSLDPRTVAEGEMALIVARL
REIAEHAAD
Download sequence
Identical sequences Q8Z2J6
gi|378961916|ref|YP_005219402.1| AE014613|CDS_3864636-3865745 AL513382|CDS_3879146-3880255 gi|16762549|ref|NP_458166.1| 209261.t3750 220341.STY4017 gi|29144038|ref|NP_807380.1| NP_458166.1.84458 WP_000188469.1.100008 WP_000188469.1.100036 WP_000188469.1.100079 WP_000188469.1.100196 WP_000188469.1.100284 WP_000188469.1.100313 WP_000188469.1.100314 WP_000188469.1.100321 WP_000188469.1.100354 WP_000188469.1.100421 WP_000188469.1.100446 WP_000188469.1.100450 WP_000188469.1.100592 WP_000188469.1.100610 WP_000188469.1.100732 WP_000188469.1.100733 WP_000188469.1.100739 WP_000188469.1.100764 WP_000188469.1.100799 WP_000188469.1.100941 WP_000188469.1.100953 WP_000188469.1.101011 WP_000188469.1.10108 WP_000188469.1.101226 WP_000188469.1.10124 WP_000188469.1.101271 WP_000188469.1.101312 WP_000188469.1.101322 WP_000188469.1.101374 WP_000188469.1.101616 WP_000188469.1.101890 WP_000188469.1.101941 WP_000188469.1.102050 WP_000188469.1.102087 WP_000188469.1.10338 WP_000188469.1.1038 WP_000188469.1.104 WP_000188469.1.10401 WP_000188469.1.10428 WP_000188469.1.10459 WP_000188469.1.10475 WP_000188469.1.10511 WP_000188469.1.10514 WP_000188469.1.10530 WP_000188469.1.10532 WP_000188469.1.10547 WP_000188469.1.10595 WP_000188469.1.10642 WP_000188469.1.10654 WP_000188469.1.10677 WP_000188469.1.10857 WP_000188469.1.10873 WP_000188469.1.10926 WP_000188469.1.10936 WP_000188469.1.11012 WP_000188469.1.11055 WP_000188469.1.11126 WP_000188469.1.11142 WP_000188469.1.11239 WP_000188469.1.11253 WP_000188469.1.11314 WP_000188469.1.11385 WP_000188469.1.1142 WP_000188469.1.11426 WP_000188469.1.11429 WP_000188469.1.11557 WP_000188469.1.11567 WP_000188469.1.11638 WP_000188469.1.11883 WP_000188469.1.11908 WP_000188469.1.11914 WP_000188469.1.12040 WP_000188469.1.12061 WP_000188469.1.1207 WP_000188469.1.12141 WP_000188469.1.12172 WP_000188469.1.12192 WP_000188469.1.1224 WP_000188469.1.12364 WP_000188469.1.12398 WP_000188469.1.12441 WP_000188469.1.12581 WP_000188469.1.12620 WP_000188469.1.12648 WP_000188469.1.12683 WP_000188469.1.12726 WP_000188469.1.12727 WP_000188469.1.12741 WP_000188469.1.12834 WP_000188469.1.13108 WP_000188469.1.13161 WP_000188469.1.1321 WP_000188469.1.13268 WP_000188469.1.13291 WP_000188469.1.133 WP_000188469.1.13314 WP_000188469.1.13338 WP_000188469.1.13342 WP_000188469.1.13352 WP_000188469.1.13406 WP_000188469.1.13440 WP_000188469.1.13443 WP_000188469.1.13476 WP_000188469.1.13599 WP_000188469.1.13686 WP_000188469.1.1372 WP_000188469.1.13732 WP_000188469.1.1382 WP_000188469.1.1397 WP_000188469.1.13972 WP_000188469.1.140 WP_000188469.1.1401 WP_000188469.1.1408 WP_000188469.1.14089 WP_000188469.1.14099 WP_000188469.1.14120 WP_000188469.1.14123 WP_000188469.1.14150 WP_000188469.1.14191 WP_000188469.1.14197 WP_000188469.1.14280 WP_000188469.1.14333 WP_000188469.1.14399 WP_000188469.1.14444 WP_000188469.1.14467 WP_000188469.1.14474 WP_000188469.1.14500 WP_000188469.1.14526 WP_000188469.1.14550 WP_000188469.1.14575 WP_000188469.1.14701 WP_000188469.1.14703 WP_000188469.1.14719 WP_000188469.1.1473 WP_000188469.1.14765 WP_000188469.1.14810 WP_000188469.1.14877 WP_000188469.1.14894 WP_000188469.1.14930 WP_000188469.1.14947 WP_000188469.1.14948 WP_000188469.1.15184 WP_000188469.1.15244 WP_000188469.1.15265 WP_000188469.1.15362 WP_000188469.1.15415 WP_000188469.1.15423 WP_000188469.1.15433 WP_000188469.1.15439 WP_000188469.1.15487 WP_000188469.1.15535 WP_000188469.1.15581 WP_000188469.1.15597 WP_000188469.1.15710 WP_000188469.1.15717 WP_000188469.1.15905 WP_000188469.1.15912 WP_000188469.1.15970 WP_000188469.1.16046 WP_000188469.1.16051 WP_000188469.1.16058 WP_000188469.1.16150 WP_000188469.1.16155 WP_000188469.1.1626 WP_000188469.1.16264 WP_000188469.1.16452 WP_000188469.1.16461 WP_000188469.1.16462 WP_000188469.1.16465 WP_000188469.1.16522 WP_000188469.1.16588 WP_000188469.1.16658 WP_000188469.1.16666 WP_000188469.1.16673 WP_000188469.1.1674 WP_000188469.1.16767 WP_000188469.1.16781 WP_000188469.1.16879 WP_000188469.1.16893 WP_000188469.1.16905 WP_000188469.1.16948 WP_000188469.1.17049 WP_000188469.1.17058 WP_000188469.1.17078 WP_000188469.1.17202 WP_000188469.1.17219 WP_000188469.1.1722 WP_000188469.1.17302 WP_000188469.1.17308 WP_000188469.1.17368 WP_000188469.1.17405 WP_000188469.1.17406 WP_000188469.1.17513 WP_000188469.1.17543 WP_000188469.1.17563 WP_000188469.1.17578 WP_000188469.1.17622 WP_000188469.1.17659 WP_000188469.1.17667 WP_000188469.1.17686 WP_000188469.1.17741 WP_000188469.1.17840 WP_000188469.1.17956 WP_000188469.1.18005 WP_000188469.1.1801 WP_000188469.1.18021 WP_000188469.1.18099 WP_000188469.1.18124 WP_000188469.1.18144 WP_000188469.1.18173 WP_000188469.1.18270 WP_000188469.1.18280 WP_000188469.1.18328 WP_000188469.1.18358 WP_000188469.1.18370 WP_000188469.1.18406 WP_000188469.1.18474 WP_000188469.1.18513 WP_000188469.1.18610 WP_000188469.1.18678 WP_000188469.1.18722 WP_000188469.1.18766 WP_000188469.1.1880 WP_000188469.1.1885 WP_000188469.1.18860 WP_000188469.1.18922 WP_000188469.1.18959 WP_000188469.1.19001 WP_000188469.1.19006 WP_000188469.1.19044 WP_000188469.1.19084 WP_000188469.1.19187 WP_000188469.1.19228 WP_000188469.1.19288 WP_000188469.1.19300 WP_000188469.1.19422 WP_000188469.1.19454 WP_000188469.1.19456 WP_000188469.1.19496 WP_000188469.1.19535 WP_000188469.1.19538 WP_000188469.1.19589 WP_000188469.1.19663 WP_000188469.1.19686 WP_000188469.1.19731 WP_000188469.1.19794 WP_000188469.1.1992 WP_000188469.1.19999 WP_000188469.1.20254 WP_000188469.1.20255 WP_000188469.1.20296 WP_000188469.1.20339 WP_000188469.1.20419 WP_000188469.1.20465 WP_000188469.1.20492 WP_000188469.1.2053 WP_000188469.1.20635 WP_000188469.1.20718 WP_000188469.1.2073 WP_000188469.1.20740 WP_000188469.1.20828 WP_000188469.1.2087 WP_000188469.1.20883 WP_000188469.1.20947 WP_000188469.1.20953 WP_000188469.1.21010 WP_000188469.1.2106 WP_000188469.1.21062 WP_000188469.1.21144 WP_000188469.1.21162 WP_000188469.1.21184 WP_000188469.1.21185 WP_000188469.1.21366 WP_000188469.1.21492 WP_000188469.1.2166 WP_000188469.1.21674 WP_000188469.1.21946 WP_000188469.1.21966 WP_000188469.1.22064 WP_000188469.1.22118 WP_000188469.1.22126 WP_000188469.1.2216 WP_000188469.1.22208 WP_000188469.1.2227 WP_000188469.1.22373 WP_000188469.1.22476 WP_000188469.1.22614 WP_000188469.1.22652 WP_000188469.1.22683 WP_000188469.1.2284 WP_000188469.1.22895 WP_000188469.1.22926 WP_000188469.1.22943 WP_000188469.1.22967 WP_000188469.1.23040 WP_000188469.1.23058 WP_000188469.1.23218 WP_000188469.1.2331 WP_000188469.1.2332 WP_000188469.1.23340 WP_000188469.1.2336 WP_000188469.1.23365 WP_000188469.1.23412 WP_000188469.1.23426 WP_000188469.1.23492 WP_000188469.1.23515 WP_000188469.1.23548 WP_000188469.1.23571 WP_000188469.1.23604 WP_000188469.1.23679 WP_000188469.1.23728 WP_000188469.1.2375 WP_000188469.1.23783 WP_000188469.1.23786 WP_000188469.1.23787 WP_000188469.1.23801 WP_000188469.1.24028 WP_000188469.1.24061 WP_000188469.1.24083 WP_000188469.1.24117 WP_000188469.1.24125 WP_000188469.1.24138 WP_000188469.1.24153 WP_000188469.1.24291 WP_000188469.1.24322 WP_000188469.1.24355 WP_000188469.1.24375 WP_000188469.1.24400 WP_000188469.1.24420 WP_000188469.1.24619 WP_000188469.1.24643 WP_000188469.1.24688 WP_000188469.1.24716 WP_000188469.1.2481 WP_000188469.1.24832 WP_000188469.1.24964 WP_000188469.1.25017 WP_000188469.1.25032 WP_000188469.1.25041 WP_000188469.1.25053 WP_000188469.1.25140 WP_000188469.1.25185 WP_000188469.1.25196 WP_000188469.1.25210 WP_000188469.1.25219 WP_000188469.1.25304 WP_000188469.1.25374 WP_000188469.1.25475 WP_000188469.1.25490 WP_000188469.1.25508 WP_000188469.1.25512 WP_000188469.1.25603 WP_000188469.1.2562 WP_000188469.1.25666 WP_000188469.1.25807 WP_000188469.1.25821 WP_000188469.1.25833 WP_000188469.1.25835 WP_000188469.1.25882 WP_000188469.1.25911 WP_000188469.1.25962 WP_000188469.1.25963 WP_000188469.1.26001 WP_000188469.1.26027 WP_000188469.1.26107 WP_000188469.1.2615 WP_000188469.1.26217 WP_000188469.1.26230 WP_000188469.1.26232 WP_000188469.1.26272 WP_000188469.1.26286 WP_000188469.1.26288 WP_000188469.1.26394 WP_000188469.1.26491 WP_000188469.1.2654 WP_000188469.1.26554 WP_000188469.1.26636 WP_000188469.1.26689 WP_000188469.1.2679 WP_000188469.1.26908 WP_000188469.1.2692 WP_000188469.1.26928 WP_000188469.1.270 WP_000188469.1.27008 WP_000188469.1.27027 WP_000188469.1.27070 WP_000188469.1.27077 WP_000188469.1.27086 WP_000188469.1.27087 WP_000188469.1.27111 WP_000188469.1.27115 WP_000188469.1.2713 WP_000188469.1.2717 WP_000188469.1.27228 WP_000188469.1.27282 WP_000188469.1.27285 WP_000188469.1.27309 WP_000188469.1.27329 WP_000188469.1.27361 WP_000188469.1.27565 WP_000188469.1.27595 WP_000188469.1.27598 WP_000188469.1.27706 WP_000188469.1.27775 WP_000188469.1.27785 WP_000188469.1.27900 WP_000188469.1.27928 WP_000188469.1.27945 WP_000188469.1.28004 WP_000188469.1.2809 WP_000188469.1.28155 WP_000188469.1.28198 WP_000188469.1.2822 WP_000188469.1.28229 WP_000188469.1.28384 WP_000188469.1.28386 WP_000188469.1.28395 WP_000188469.1.284 WP_000188469.1.2845 WP_000188469.1.28479 WP_000188469.1.28627 WP_000188469.1.28692 WP_000188469.1.2873 WP_000188469.1.28917 WP_000188469.1.28962 WP_000188469.1.29023 WP_000188469.1.29042 WP_000188469.1.2905 WP_000188469.1.2907 WP_000188469.1.29081 WP_000188469.1.29089 WP_000188469.1.29153 WP_000188469.1.29203 WP_000188469.1.29237 WP_000188469.1.29248 WP_000188469.1.29288 WP_000188469.1.29389 WP_000188469.1.29439 WP_000188469.1.2946 WP_000188469.1.29462 WP_000188469.1.29563 WP_000188469.1.29727 WP_000188469.1.29743 WP_000188469.1.29782 WP_000188469.1.29833 WP_000188469.1.29851 WP_000188469.1.29865 WP_000188469.1.29886 WP_000188469.1.29919 WP_000188469.1.2994 WP_000188469.1.29964 WP_000188469.1.29983 WP_000188469.1.30009 WP_000188469.1.30013 WP_000188469.1.3002 WP_000188469.1.30034 WP_000188469.1.30049 WP_000188469.1.30058 WP_000188469.1.30172 WP_000188469.1.30185 WP_000188469.1.30354 WP_000188469.1.30357 WP_000188469.1.30362 WP_000188469.1.3042 WP_000188469.1.30421 WP_000188469.1.30440 WP_000188469.1.30448 WP_000188469.1.30489 WP_000188469.1.30517 WP_000188469.1.30542 WP_000188469.1.30544 WP_000188469.1.30556 WP_000188469.1.30572 WP_000188469.1.30585 WP_000188469.1.30618 WP_000188469.1.30664 WP_000188469.1.30688 WP_000188469.1.30806 WP_000188469.1.30967 WP_000188469.1.31046 WP_000188469.1.31066 WP_000188469.1.31078 WP_000188469.1.31139 WP_000188469.1.31145 WP_000188469.1.31182 WP_000188469.1.31205 WP_000188469.1.3121 WP_000188469.1.31223 WP_000188469.1.31303 WP_000188469.1.3131 WP_000188469.1.31352 WP_000188469.1.31389 WP_000188469.1.31413 WP_000188469.1.31446 WP_000188469.1.31533 WP_000188469.1.31799 WP_000188469.1.31836 WP_000188469.1.31951 WP_000188469.1.32041 WP_000188469.1.32042 WP_000188469.1.3207 WP_000188469.1.32189 WP_000188469.1.32202 WP_000188469.1.32263 WP_000188469.1.32293 WP_000188469.1.32299 WP_000188469.1.32422 WP_000188469.1.32425 WP_000188469.1.32458 WP_000188469.1.32460 WP_000188469.1.32529 WP_000188469.1.32563 WP_000188469.1.32578 WP_000188469.1.32617 WP_000188469.1.3270 WP_000188469.1.32725 WP_000188469.1.32838 WP_000188469.1.32848 WP_000188469.1.32868 WP_000188469.1.3290 WP_000188469.1.32940 WP_000188469.1.32941 WP_000188469.1.3296 WP_000188469.1.32966 WP_000188469.1.32985 WP_000188469.1.33037 WP_000188469.1.3305 WP_000188469.1.33051 WP_000188469.1.33065 WP_000188469.1.33122 WP_000188469.1.3315 WP_000188469.1.33208 WP_000188469.1.33214 WP_000188469.1.33247 WP_000188469.1.33280 WP_000188469.1.33283 WP_000188469.1.33313 WP_000188469.1.33339 WP_000188469.1.33382 WP_000188469.1.33490 WP_000188469.1.33501 WP_000188469.1.33529 WP_000188469.1.33689 WP_000188469.1.3370 WP_000188469.1.33730 WP_000188469.1.33741 WP_000188469.1.33840 WP_000188469.1.3392 WP_000188469.1.33926 WP_000188469.1.33957 WP_000188469.1.33969 WP_000188469.1.34001 WP_000188469.1.34059 WP_000188469.1.34118 WP_000188469.1.34211 WP_000188469.1.34214 WP_000188469.1.34234 WP_000188469.1.34284 WP_000188469.1.34376 WP_000188469.1.34382 WP_000188469.1.34484 WP_000188469.1.34517 WP_000188469.1.34530 WP_000188469.1.34665 WP_000188469.1.34694 WP_000188469.1.34751 WP_000188469.1.34808 WP_000188469.1.34824 WP_000188469.1.34834 WP_000188469.1.34932 WP_000188469.1.34962 WP_000188469.1.35001 WP_000188469.1.35040 WP_000188469.1.35074 WP_000188469.1.35175 WP_000188469.1.35240 WP_000188469.1.35274 WP_000188469.1.35532 WP_000188469.1.35560 WP_000188469.1.3557 WP_000188469.1.35628 WP_000188469.1.3570 WP_000188469.1.35712 WP_000188469.1.35713 WP_000188469.1.35736 WP_000188469.1.35791 WP_000188469.1.35795 WP_000188469.1.35870 WP_000188469.1.35916 WP_000188469.1.35938 WP_000188469.1.35966 WP_000188469.1.36000 WP_000188469.1.36034 WP_000188469.1.36036 WP_000188469.1.36069 WP_000188469.1.36291 WP_000188469.1.36298 WP_000188469.1.36308 WP_000188469.1.36323 WP_000188469.1.36343 WP_000188469.1.36460 WP_000188469.1.3649 WP_000188469.1.36495 WP_000188469.1.36526 WP_000188469.1.36567 WP_000188469.1.36579 WP_000188469.1.36617 WP_000188469.1.36618 WP_000188469.1.36643 WP_000188469.1.36663 WP_000188469.1.36701 WP_000188469.1.36725 WP_000188469.1.36779 WP_000188469.1.36798 WP_000188469.1.36802 WP_000188469.1.36821 WP_000188469.1.36853 WP_000188469.1.36950 WP_000188469.1.37014 WP_000188469.1.37133 WP_000188469.1.37176 WP_000188469.1.37199 WP_000188469.1.37200 WP_000188469.1.37258 WP_000188469.1.37303 WP_000188469.1.37513 WP_000188469.1.37584 WP_000188469.1.37590 WP_000188469.1.37593 WP_000188469.1.37600 WP_000188469.1.37613 WP_000188469.1.37659 WP_000188469.1.37662 WP_000188469.1.37675 WP_000188469.1.37691 WP_000188469.1.37761 WP_000188469.1.37775 WP_000188469.1.37777 WP_000188469.1.378 WP_000188469.1.379 WP_000188469.1.37911 WP_000188469.1.37941 WP_000188469.1.37985 WP_000188469.1.38061 WP_000188469.1.38064 WP_000188469.1.38108 WP_000188469.1.3816 WP_000188469.1.38207 WP_000188469.1.38261 WP_000188469.1.38266 WP_000188469.1.38310 WP_000188469.1.3834 WP_000188469.1.38351 WP_000188469.1.3838 WP_000188469.1.38381 WP_000188469.1.38440 WP_000188469.1.38486 WP_000188469.1.38515 WP_000188469.1.38595 WP_000188469.1.3860 WP_000188469.1.38642 WP_000188469.1.38734 WP_000188469.1.38877 WP_000188469.1.38983 WP_000188469.1.38996 WP_000188469.1.39056 WP_000188469.1.3907 WP_000188469.1.39105 WP_000188469.1.3914 WP_000188469.1.39147 WP_000188469.1.39161 WP_000188469.1.39210 WP_000188469.1.39235 WP_000188469.1.3931 WP_000188469.1.39435 WP_000188469.1.39502 WP_000188469.1.39530 WP_000188469.1.39619 WP_000188469.1.39620 WP_000188469.1.39624 WP_000188469.1.39659 WP_000188469.1.39667 WP_000188469.1.39775 WP_000188469.1.39879 WP_000188469.1.39890 WP_000188469.1.39941 WP_000188469.1.39945 WP_000188469.1.39947 WP_000188469.1.40095 WP_000188469.1.40097 WP_000188469.1.401 WP_000188469.1.40160 WP_000188469.1.40167 WP_000188469.1.40279 WP_000188469.1.40361 WP_000188469.1.4042 WP_000188469.1.40467 WP_000188469.1.40496 WP_000188469.1.40517 WP_000188469.1.40698 WP_000188469.1.40750 WP_000188469.1.40763 WP_000188469.1.40854 WP_000188469.1.4089 WP_000188469.1.40924 WP_000188469.1.40932 WP_000188469.1.40946 WP_000188469.1.41004 WP_000188469.1.4106 WP_000188469.1.41070 WP_000188469.1.41074 WP_000188469.1.41075 WP_000188469.1.41097 WP_000188469.1.41132 WP_000188469.1.41176 WP_000188469.1.41251 WP_000188469.1.41258 WP_000188469.1.41305 WP_000188469.1.41321 WP_000188469.1.41333 WP_000188469.1.41335 WP_000188469.1.4136 WP_000188469.1.41415 WP_000188469.1.41459 WP_000188469.1.41498 WP_000188469.1.41519 WP_000188469.1.41524 WP_000188469.1.41631 WP_000188469.1.41658 WP_000188469.1.41659 WP_000188469.1.41716 WP_000188469.1.41746 WP_000188469.1.41824 WP_000188469.1.41825 WP_000188469.1.41836 WP_000188469.1.41894 WP_000188469.1.41919 WP_000188469.1.41929 WP_000188469.1.42069 WP_000188469.1.42081 WP_000188469.1.42090 WP_000188469.1.42111 WP_000188469.1.42187 WP_000188469.1.42200 WP_000188469.1.42219 WP_000188469.1.42257 WP_000188469.1.42261 WP_000188469.1.42349 WP_000188469.1.42364 WP_000188469.1.42371 WP_000188469.1.42379 WP_000188469.1.42391 WP_000188469.1.42399 WP_000188469.1.42539 WP_000188469.1.42603 WP_000188469.1.42650 WP_000188469.1.4267 WP_000188469.1.42701 WP_000188469.1.42805 WP_000188469.1.42815 WP_000188469.1.42859 WP_000188469.1.4298 WP_000188469.1.43008 WP_000188469.1.43016 WP_000188469.1.43019 WP_000188469.1.43065 WP_000188469.1.43068 WP_000188469.1.43069 WP_000188469.1.43128 WP_000188469.1.43141 WP_000188469.1.43157 WP_000188469.1.43161 WP_000188469.1.43190 WP_000188469.1.43198 WP_000188469.1.4326 WP_000188469.1.43290 WP_000188469.1.43292 WP_000188469.1.43307 WP_000188469.1.43513 WP_000188469.1.43633 WP_000188469.1.43637 WP_000188469.1.43651 WP_000188469.1.43722 WP_000188469.1.43801 WP_000188469.1.43812 WP_000188469.1.43878 WP_000188469.1.43888 WP_000188469.1.43919 WP_000188469.1.43974 WP_000188469.1.44049 WP_000188469.1.44101 WP_000188469.1.44160 WP_000188469.1.44180 WP_000188469.1.44196 WP_000188469.1.44248 WP_000188469.1.44262 WP_000188469.1.44268 WP_000188469.1.4427 WP_000188469.1.44296 WP_000188469.1.44343 WP_000188469.1.44351 WP_000188469.1.44360 WP_000188469.1.44416 WP_000188469.1.44431 WP_000188469.1.44437 WP_000188469.1.44546 WP_000188469.1.4468 WP_000188469.1.44762 WP_000188469.1.44815 WP_000188469.1.44828 WP_000188469.1.44879 WP_000188469.1.44917 WP_000188469.1.4501 WP_000188469.1.45072 WP_000188469.1.45093 WP_000188469.1.45136 WP_000188469.1.45241 WP_000188469.1.45435 WP_000188469.1.45523 WP_000188469.1.45596 WP_000188469.1.45648 WP_000188469.1.45829 WP_000188469.1.45871 WP_000188469.1.46030 WP_000188469.1.46077 WP_000188469.1.46169 WP_000188469.1.46225 WP_000188469.1.46241 WP_000188469.1.46307 WP_000188469.1.46355 WP_000188469.1.464 WP_000188469.1.46454 WP_000188469.1.46461 WP_000188469.1.46504 WP_000188469.1.46505 WP_000188469.1.46551 WP_000188469.1.46559 WP_000188469.1.46701 WP_000188469.1.46781 WP_000188469.1.46816 WP_000188469.1.46842 WP_000188469.1.4690 WP_000188469.1.46920 WP_000188469.1.46945 WP_000188469.1.47036 WP_000188469.1.47037 WP_000188469.1.47042 WP_000188469.1.47059 WP_000188469.1.47085 WP_000188469.1.47123 WP_000188469.1.47215 WP_000188469.1.47245 WP_000188469.1.47523 WP_000188469.1.47531 WP_000188469.1.47532 WP_000188469.1.47605 WP_000188469.1.47630 WP_000188469.1.4774 WP_000188469.1.47756 WP_000188469.1.4781 WP_000188469.1.47886 WP_000188469.1.47898 WP_000188469.1.48019 WP_000188469.1.48100 WP_000188469.1.48114 WP_000188469.1.48139 WP_000188469.1.48190 WP_000188469.1.48292 WP_000188469.1.48324 WP_000188469.1.48426 WP_000188469.1.48430 WP_000188469.1.48436 WP_000188469.1.48586 WP_000188469.1.4859 WP_000188469.1.48591 WP_000188469.1.48610 WP_000188469.1.48631 WP_000188469.1.48663 WP_000188469.1.48690 WP_000188469.1.48734 WP_000188469.1.48756 WP_000188469.1.48778 WP_000188469.1.48849 WP_000188469.1.48955 WP_000188469.1.48963 WP_000188469.1.48973 WP_000188469.1.49004 WP_000188469.1.49106 WP_000188469.1.49117 WP_000188469.1.49121 WP_000188469.1.4914 WP_000188469.1.49140 WP_000188469.1.49153 WP_000188469.1.49166 WP_000188469.1.49355 WP_000188469.1.49429 WP_000188469.1.49434 WP_000188469.1.49450 WP_000188469.1.495 WP_000188469.1.49545 WP_000188469.1.49703 WP_000188469.1.49769 WP_000188469.1.49846 WP_000188469.1.4991 WP_000188469.1.49947 WP_000188469.1.49959 WP_000188469.1.49997 WP_000188469.1.50014 WP_000188469.1.50030 WP_000188469.1.50043 WP_000188469.1.50103 WP_000188469.1.50158 WP_000188469.1.50247 WP_000188469.1.50308 WP_000188469.1.50309 WP_000188469.1.50387 WP_000188469.1.50406 WP_000188469.1.50468 WP_000188469.1.5051 WP_000188469.1.50566 WP_000188469.1.50570 WP_000188469.1.50626 WP_000188469.1.50726 WP_000188469.1.50771 WP_000188469.1.50875 WP_000188469.1.50885 WP_000188469.1.509 WP_000188469.1.50929 WP_000188469.1.50970 WP_000188469.1.51040 WP_000188469.1.51048 WP_000188469.1.51100 WP_000188469.1.51134 WP_000188469.1.51227 WP_000188469.1.5127 WP_000188469.1.51305 WP_000188469.1.51315 WP_000188469.1.5136 WP_000188469.1.51474 WP_000188469.1.51519 WP_000188469.1.51598 WP_000188469.1.51644 WP_000188469.1.51724 WP_000188469.1.51734 WP_000188469.1.51838 WP_000188469.1.51863 WP_000188469.1.51935 WP_000188469.1.52057 WP_000188469.1.52129 WP_000188469.1.52191 WP_000188469.1.52202 WP_000188469.1.52209 WP_000188469.1.52339 WP_000188469.1.52469 WP_000188469.1.52571 WP_000188469.1.526 WP_000188469.1.52647 WP_000188469.1.52742 WP_000188469.1.52773 WP_000188469.1.52795 WP_000188469.1.52807 WP_000188469.1.52887 WP_000188469.1.53092 WP_000188469.1.53141 WP_000188469.1.53151 WP_000188469.1.53159 WP_000188469.1.53210 WP_000188469.1.53233 WP_000188469.1.53307 WP_000188469.1.53321 WP_000188469.1.53368 WP_000188469.1.53375 WP_000188469.1.53450 WP_000188469.1.5349 WP_000188469.1.53540 WP_000188469.1.53555 WP_000188469.1.53559 WP_000188469.1.5356 WP_000188469.1.53571 WP_000188469.1.5358 WP_000188469.1.53692 WP_000188469.1.53723 WP_000188469.1.5374 WP_000188469.1.53750 WP_000188469.1.53800 WP_000188469.1.53815 WP_000188469.1.53839 WP_000188469.1.53892 WP_000188469.1.53898 WP_000188469.1.53902 WP_000188469.1.53958 WP_000188469.1.53981 WP_000188469.1.53984 WP_000188469.1.54132 WP_000188469.1.54170 WP_000188469.1.54175 WP_000188469.1.54203 WP_000188469.1.54259 WP_000188469.1.5430 WP_000188469.1.54371 WP_000188469.1.54431 WP_000188469.1.54442 WP_000188469.1.54482 WP_000188469.1.54589 WP_000188469.1.54667 WP_000188469.1.54678 WP_000188469.1.54681 WP_000188469.1.54748 WP_000188469.1.5481 WP_000188469.1.54865 WP_000188469.1.54935 WP_000188469.1.54979 WP_000188469.1.55010 WP_000188469.1.55034 WP_000188469.1.55163 WP_000188469.1.55165 WP_000188469.1.55215 WP_000188469.1.55290 WP_000188469.1.55310 WP_000188469.1.55317 WP_000188469.1.55379 WP_000188469.1.5539 WP_000188469.1.55468 WP_000188469.1.55506 WP_000188469.1.55604 WP_000188469.1.55639 WP_000188469.1.55699 WP_000188469.1.55725 WP_000188469.1.55780 WP_000188469.1.55967 WP_000188469.1.56144 WP_000188469.1.56172 WP_000188469.1.5621 WP_000188469.1.56226 WP_000188469.1.56311 WP_000188469.1.56419 WP_000188469.1.56423 WP_000188469.1.56514 WP_000188469.1.56535 WP_000188469.1.56585 WP_000188469.1.56640 WP_000188469.1.56724 WP_000188469.1.56825 WP_000188469.1.56887 WP_000188469.1.56889 WP_000188469.1.56981 WP_000188469.1.57101 WP_000188469.1.57137 WP_000188469.1.57147 WP_000188469.1.57179 WP_000188469.1.57186 WP_000188469.1.57342 WP_000188469.1.57684 WP_000188469.1.57699 WP_000188469.1.57785 WP_000188469.1.57800 WP_000188469.1.57873 WP_000188469.1.57965 WP_000188469.1.57972 WP_000188469.1.58008 WP_000188469.1.58044 WP_000188469.1.58081 WP_000188469.1.5809 WP_000188469.1.58132 WP_000188469.1.58173 WP_000188469.1.58191 WP_000188469.1.58194 WP_000188469.1.58252 WP_000188469.1.58261 WP_000188469.1.58274 WP_000188469.1.58282 WP_000188469.1.58324 WP_000188469.1.58326 WP_000188469.1.5836 WP_000188469.1.58485 WP_000188469.1.58537 WP_000188469.1.58568 WP_000188469.1.58583 WP_000188469.1.58652 WP_000188469.1.58663 WP_000188469.1.58724 WP_000188469.1.5875 WP_000188469.1.58796 WP_000188469.1.58807 WP_000188469.1.58847 WP_000188469.1.58883 WP_000188469.1.58898 WP_000188469.1.58949 WP_000188469.1.58963 WP_000188469.1.58970 WP_000188469.1.58974 WP_000188469.1.59020 WP_000188469.1.59043 WP_000188469.1.59056 WP_000188469.1.59061 WP_000188469.1.59064 WP_000188469.1.59299 WP_000188469.1.59313 WP_000188469.1.5949 WP_000188469.1.59501 WP_000188469.1.59510 WP_000188469.1.5969 WP_000188469.1.59751 WP_000188469.1.59827 WP_000188469.1.59829 WP_000188469.1.59847 WP_000188469.1.59863 WP_000188469.1.59969 WP_000188469.1.59994 WP_000188469.1.60045 WP_000188469.1.60076 WP_000188469.1.60114 WP_000188469.1.60154 WP_000188469.1.60168 WP_000188469.1.60192 WP_000188469.1.60199 WP_000188469.1.60212 WP_000188469.1.60253 WP_000188469.1.60322 WP_000188469.1.60324 WP_000188469.1.60356 WP_000188469.1.6038 WP_000188469.1.60380 WP_000188469.1.6041 WP_000188469.1.60424 WP_000188469.1.60481 WP_000188469.1.605 WP_000188469.1.6058 WP_000188469.1.60584 WP_000188469.1.6060 WP_000188469.1.60676 WP_000188469.1.60708 WP_000188469.1.60725 WP_000188469.1.60783 WP_000188469.1.60792 WP_000188469.1.60807 WP_000188469.1.60882 WP_000188469.1.60889 WP_000188469.1.60950 WP_000188469.1.6104 WP_000188469.1.61044 WP_000188469.1.61076 WP_000188469.1.61123 WP_000188469.1.61147 WP_000188469.1.61168 WP_000188469.1.61210 WP_000188469.1.61357 WP_000188469.1.61511 WP_000188469.1.61539 WP_000188469.1.61542 WP_000188469.1.61649 WP_000188469.1.61652 WP_000188469.1.61697 WP_000188469.1.61809 WP_000188469.1.61877 WP_000188469.1.61920 WP_000188469.1.62124 WP_000188469.1.62199 WP_000188469.1.62223 WP_000188469.1.62302 WP_000188469.1.62314 WP_000188469.1.62323 WP_000188469.1.62333 WP_000188469.1.62338 WP_000188469.1.62380 WP_000188469.1.62411 WP_000188469.1.62436 WP_000188469.1.62475 WP_000188469.1.62536 WP_000188469.1.62640 WP_000188469.1.62686 WP_000188469.1.62751 WP_000188469.1.62825 WP_000188469.1.62913 WP_000188469.1.62932 WP_000188469.1.62960 WP_000188469.1.63016 WP_000188469.1.63025 WP_000188469.1.63069 WP_000188469.1.63087 WP_000188469.1.63169 WP_000188469.1.63297 WP_000188469.1.63448 WP_000188469.1.63514 WP_000188469.1.63583 WP_000188469.1.63592 WP_000188469.1.63663 WP_000188469.1.63736 WP_000188469.1.63816 WP_000188469.1.63876 WP_000188469.1.6389 WP_000188469.1.63901 WP_000188469.1.63955 WP_000188469.1.63963 WP_000188469.1.64032 WP_000188469.1.64087 WP_000188469.1.6415 WP_000188469.1.64293 WP_000188469.1.64332 WP_000188469.1.64376 WP_000188469.1.644 WP_000188469.1.64471 WP_000188469.1.64501 WP_000188469.1.64538 WP_000188469.1.64632 WP_000188469.1.64648 WP_000188469.1.64654 WP_000188469.1.64662 WP_000188469.1.64663 WP_000188469.1.64709 WP_000188469.1.64710 WP_000188469.1.64744 WP_000188469.1.64763 WP_000188469.1.64817 WP_000188469.1.64847 WP_000188469.1.6487 WP_000188469.1.64891 WP_000188469.1.64974 WP_000188469.1.65054 WP_000188469.1.65075 WP_000188469.1.6514 WP_000188469.1.65172 WP_000188469.1.65191 WP_000188469.1.65200 WP_000188469.1.65211 WP_000188469.1.65218 WP_000188469.1.65226 WP_000188469.1.65249 WP_000188469.1.65266 WP_000188469.1.65395 WP_000188469.1.65459 WP_000188469.1.65463 WP_000188469.1.65487 WP_000188469.1.6549 WP_000188469.1.65499 WP_000188469.1.6554 WP_000188469.1.65650 WP_000188469.1.65697 WP_000188469.1.65699 WP_000188469.1.65737 WP_000188469.1.65755 WP_000188469.1.65812 WP_000188469.1.65846 WP_000188469.1.65863 WP_000188469.1.65985 WP_000188469.1.66021 WP_000188469.1.66031 WP_000188469.1.66052 WP_000188469.1.66064 WP_000188469.1.66109 WP_000188469.1.66145 WP_000188469.1.66183 WP_000188469.1.6620 WP_000188469.1.66216 WP_000188469.1.66234 WP_000188469.1.66273 WP_000188469.1.66324 WP_000188469.1.6634 WP_000188469.1.66361 WP_000188469.1.66480 WP_000188469.1.66506 WP_000188469.1.66665 WP_000188469.1.66681 WP_000188469.1.66684 WP_000188469.1.66755 WP_000188469.1.66759 WP_000188469.1.66801 WP_000188469.1.66860 WP_000188469.1.66953 WP_000188469.1.66955 WP_000188469.1.66981 WP_000188469.1.67024 WP_000188469.1.67042 WP_000188469.1.67101 WP_000188469.1.67143 WP_000188469.1.67201 WP_000188469.1.67211 WP_000188469.1.67237 WP_000188469.1.67336 WP_000188469.1.67339 WP_000188469.1.67387 WP_000188469.1.67394 WP_000188469.1.67397 WP_000188469.1.67403 WP_000188469.1.67430 WP_000188469.1.67442 WP_000188469.1.67539 WP_000188469.1.67556 WP_000188469.1.67576 WP_000188469.1.67604 WP_000188469.1.67619 WP_000188469.1.67625 WP_000188469.1.67627 WP_000188469.1.67641 WP_000188469.1.67657 WP_000188469.1.67673 WP_000188469.1.67700 WP_000188469.1.67718 WP_000188469.1.67729 WP_000188469.1.67774 WP_000188469.1.67820 WP_000188469.1.67910 WP_000188469.1.67954 WP_000188469.1.68 WP_000188469.1.68043 WP_000188469.1.68105 WP_000188469.1.68113 WP_000188469.1.68131 WP_000188469.1.68182 WP_000188469.1.6819 WP_000188469.1.68285 WP_000188469.1.68359 WP_000188469.1.68420 WP_000188469.1.68514 WP_000188469.1.68564 WP_000188469.1.68688 WP_000188469.1.68742 WP_000188469.1.68770 WP_000188469.1.68809 WP_000188469.1.68914 WP_000188469.1.69053 WP_000188469.1.69170 WP_000188469.1.69210 WP_000188469.1.69270 WP_000188469.1.69282 WP_000188469.1.69376 WP_000188469.1.69396 WP_000188469.1.69466 WP_000188469.1.69611 WP_000188469.1.69642 WP_000188469.1.69656 WP_000188469.1.69657 WP_000188469.1.69690 WP_000188469.1.69923 WP_000188469.1.69948 WP_000188469.1.69953 WP_000188469.1.70010 WP_000188469.1.70049 WP_000188469.1.70058 WP_000188469.1.70061 WP_000188469.1.70205 WP_000188469.1.70240 WP_000188469.1.70249 WP_000188469.1.70261 WP_000188469.1.70314 WP_000188469.1.7033 WP_000188469.1.70427 WP_000188469.1.70433 WP_000188469.1.70545 WP_000188469.1.70623 WP_000188469.1.70671 WP_000188469.1.70708 WP_000188469.1.70717 WP_000188469.1.70731 WP_000188469.1.70772 WP_000188469.1.70845 WP_000188469.1.70846 WP_000188469.1.70981 WP_000188469.1.70995 WP_000188469.1.71039 WP_000188469.1.71057 WP_000188469.1.71081 WP_000188469.1.71117 WP_000188469.1.71186 WP_000188469.1.71455 WP_000188469.1.71456 WP_000188469.1.71487 WP_000188469.1.71523 WP_000188469.1.71542 WP_000188469.1.71566 WP_000188469.1.71640 WP_000188469.1.71651 WP_000188469.1.71653 WP_000188469.1.71716 WP_000188469.1.71872 WP_000188469.1.71950 WP_000188469.1.71954 WP_000188469.1.71985 WP_000188469.1.72003 WP_000188469.1.72073 WP_000188469.1.72269 WP_000188469.1.72350 WP_000188469.1.72383 WP_000188469.1.72461 WP_000188469.1.72527 WP_000188469.1.7255 WP_000188469.1.72631 WP_000188469.1.72638 WP_000188469.1.72667 WP_000188469.1.72674 WP_000188469.1.72724 WP_000188469.1.72789 WP_000188469.1.72828 WP_000188469.1.72896 WP_000188469.1.72969 WP_000188469.1.72987 WP_000188469.1.73052 WP_000188469.1.73114 WP_000188469.1.73177 WP_000188469.1.73180 WP_000188469.1.73258 WP_000188469.1.73285 WP_000188469.1.7332 WP_000188469.1.7333 WP_000188469.1.73352 WP_000188469.1.73389 WP_000188469.1.7341 WP_000188469.1.73425 WP_000188469.1.73488 WP_000188469.1.73504 WP_000188469.1.7353 WP_000188469.1.73544 WP_000188469.1.73598 WP_000188469.1.7361 WP_000188469.1.73648 WP_000188469.1.73768 WP_000188469.1.73849 WP_000188469.1.73948 WP_000188469.1.73999 WP_000188469.1.74024 WP_000188469.1.74030 WP_000188469.1.74038 WP_000188469.1.74043 WP_000188469.1.74058 WP_000188469.1.74070 WP_000188469.1.74077 WP_000188469.1.74135 WP_000188469.1.74214 WP_000188469.1.74241 WP_000188469.1.74285 WP_000188469.1.7430 WP_000188469.1.74317 WP_000188469.1.74415 WP_000188469.1.74616 WP_000188469.1.74621 WP_000188469.1.74647 WP_000188469.1.74677 WP_000188469.1.74699 WP_000188469.1.74831 WP_000188469.1.74894 WP_000188469.1.74929 WP_000188469.1.74939 WP_000188469.1.74973 WP_000188469.1.7507 WP_000188469.1.75089 WP_000188469.1.75116 WP_000188469.1.75237 WP_000188469.1.75273 WP_000188469.1.75296 WP_000188469.1.75413 WP_000188469.1.75433 WP_000188469.1.75532 WP_000188469.1.75565 WP_000188469.1.75593 WP_000188469.1.75610 WP_000188469.1.75633 WP_000188469.1.75718 WP_000188469.1.75745 WP_000188469.1.75844 WP_000188469.1.75886 WP_000188469.1.75898 WP_000188469.1.76081 WP_000188469.1.76116 WP_000188469.1.76122 WP_000188469.1.76256 WP_000188469.1.76339 WP_000188469.1.76417 WP_000188469.1.7646 WP_000188469.1.76510 WP_000188469.1.76558 WP_000188469.1.76572 WP_000188469.1.76641 WP_000188469.1.76651 WP_000188469.1.76653 WP_000188469.1.76788 WP_000188469.1.76854 WP_000188469.1.76916 WP_000188469.1.76932 WP_000188469.1.76973 WP_000188469.1.76988 WP_000188469.1.77016 WP_000188469.1.77087 WP_000188469.1.77090 WP_000188469.1.77111 WP_000188469.1.77299 WP_000188469.1.77384 WP_000188469.1.77501 WP_000188469.1.77512 WP_000188469.1.77513 WP_000188469.1.77563 WP_000188469.1.77702 WP_000188469.1.77713 WP_000188469.1.7772 WP_000188469.1.77825 WP_000188469.1.77837 WP_000188469.1.77900 WP_000188469.1.77923 WP_000188469.1.77975 WP_000188469.1.78035 WP_000188469.1.78048 WP_000188469.1.78107 WP_000188469.1.78166 WP_000188469.1.78192 WP_000188469.1.78195 WP_000188469.1.78291 WP_000188469.1.78309 WP_000188469.1.78320 WP_000188469.1.78382 WP_000188469.1.78388 WP_000188469.1.78410 WP_000188469.1.7862 WP_000188469.1.78626 WP_000188469.1.78661 WP_000188469.1.78674 WP_000188469.1.78676 WP_000188469.1.78761 WP_000188469.1.789 WP_000188469.1.78993 WP_000188469.1.79012 WP_000188469.1.79069 WP_000188469.1.79074 WP_000188469.1.79098 WP_000188469.1.79155 WP_000188469.1.79164 WP_000188469.1.79204 WP_000188469.1.79280 WP_000188469.1.79397 WP_000188469.1.79456 WP_000188469.1.79532 WP_000188469.1.79547 WP_000188469.1.79654 WP_000188469.1.7970 WP_000188469.1.79722 WP_000188469.1.79772 WP_000188469.1.79880 WP_000188469.1.79916 WP_000188469.1.80065 WP_000188469.1.80103 WP_000188469.1.80273 WP_000188469.1.80282 WP_000188469.1.80354 WP_000188469.1.80368 WP_000188469.1.80386 WP_000188469.1.80400 WP_000188469.1.80462 WP_000188469.1.8049 WP_000188469.1.80492 WP_000188469.1.80569 WP_000188469.1.80664 WP_000188469.1.80696 WP_000188469.1.80984 WP_000188469.1.81131 WP_000188469.1.81187 WP_000188469.1.81262 WP_000188469.1.81268 WP_000188469.1.81269 WP_000188469.1.81271 WP_000188469.1.8131 WP_000188469.1.81333 WP_000188469.1.81342 WP_000188469.1.81364 WP_000188469.1.81494 WP_000188469.1.81557 WP_000188469.1.81676 WP_000188469.1.81681 WP_000188469.1.8170 WP_000188469.1.81763 WP_000188469.1.81855 WP_000188469.1.81921 WP_000188469.1.81931 WP_000188469.1.81936 WP_000188469.1.81949 WP_000188469.1.82070 WP_000188469.1.82076 WP_000188469.1.82131 WP_000188469.1.82156 WP_000188469.1.8218 WP_000188469.1.82180 WP_000188469.1.82201 WP_000188469.1.82214 WP_000188469.1.82225 WP_000188469.1.8240 WP_000188469.1.82408 WP_000188469.1.82416 WP_000188469.1.8242 WP_000188469.1.82456 WP_000188469.1.82465 WP_000188469.1.82473 WP_000188469.1.82553 WP_000188469.1.82646 WP_000188469.1.82670 WP_000188469.1.82731 WP_000188469.1.82812 WP_000188469.1.82850 WP_000188469.1.82872 WP_000188469.1.8294 WP_000188469.1.82959 WP_000188469.1.83007 WP_000188469.1.8304 WP_000188469.1.83180 WP_000188469.1.83229 WP_000188469.1.83235 WP_000188469.1.83290 WP_000188469.1.83333 WP_000188469.1.83657 WP_000188469.1.83677 WP_000188469.1.8375 WP_000188469.1.83923 WP_000188469.1.83994 WP_000188469.1.84 WP_000188469.1.8406 WP_000188469.1.84076 WP_000188469.1.84110 WP_000188469.1.84127 WP_000188469.1.84150 WP_000188469.1.84230 WP_000188469.1.84252 WP_000188469.1.8431 WP_000188469.1.84345 WP_000188469.1.84369 WP_000188469.1.84401 WP_000188469.1.84435 WP_000188469.1.84567 WP_000188469.1.84631 WP_000188469.1.84727 WP_000188469.1.84744 WP_000188469.1.84773 WP_000188469.1.84945 WP_000188469.1.84967 WP_000188469.1.85004 WP_000188469.1.8502 WP_000188469.1.85039 WP_000188469.1.85153 WP_000188469.1.85273 WP_000188469.1.85338 WP_000188469.1.85339 WP_000188469.1.85511 WP_000188469.1.85512 WP_000188469.1.8557 WP_000188469.1.85606 WP_000188469.1.85635 WP_000188469.1.85646 WP_000188469.1.85665 WP_000188469.1.85669 WP_000188469.1.85688 WP_000188469.1.85703 WP_000188469.1.85728 WP_000188469.1.85746 WP_000188469.1.85811 WP_000188469.1.859 WP_000188469.1.85917 WP_000188469.1.8594 WP_000188469.1.85977 WP_000188469.1.860 WP_000188469.1.8605 WP_000188469.1.86084 WP_000188469.1.8610 WP_000188469.1.8614 WP_000188469.1.86156 WP_000188469.1.86323 WP_000188469.1.86342 WP_000188469.1.8640 WP_000188469.1.8642 WP_000188469.1.86426 WP_000188469.1.86489 WP_000188469.1.86530 WP_000188469.1.86663 WP_000188469.1.86770 WP_000188469.1.86794 WP_000188469.1.86800 WP_000188469.1.86811 WP_000188469.1.86815 WP_000188469.1.86945 WP_000188469.1.86989 WP_000188469.1.87023 WP_000188469.1.87034 WP_000188469.1.87041 WP_000188469.1.87136 WP_000188469.1.87155 WP_000188469.1.87258 WP_000188469.1.87293 WP_000188469.1.87420 WP_000188469.1.87528 WP_000188469.1.87560 WP_000188469.1.8760 WP_000188469.1.87600 WP_000188469.1.87609 WP_000188469.1.87612 WP_000188469.1.87615 WP_000188469.1.87653 WP_000188469.1.87659 WP_000188469.1.87698 WP_000188469.1.87706 WP_000188469.1.87739 WP_000188469.1.87741 WP_000188469.1.87742 WP_000188469.1.87852 WP_000188469.1.87949 WP_000188469.1.88025 WP_000188469.1.88026 WP_000188469.1.8805 WP_000188469.1.8806 WP_000188469.1.881 WP_000188469.1.88145 WP_000188469.1.88199 WP_000188469.1.88299 WP_000188469.1.88313 WP_000188469.1.88359 WP_000188469.1.88407 WP_000188469.1.88414 WP_000188469.1.88444 WP_000188469.1.88446 WP_000188469.1.88458 WP_000188469.1.88501 WP_000188469.1.88538 WP_000188469.1.88547 WP_000188469.1.886 WP_000188469.1.88647 WP_000188469.1.88648 WP_000188469.1.88692 WP_000188469.1.88707 WP_000188469.1.88727 WP_000188469.1.88772 WP_000188469.1.88850 WP_000188469.1.8889 WP_000188469.1.88892 WP_000188469.1.88894 WP_000188469.1.89182 WP_000188469.1.89298 WP_000188469.1.89308 WP_000188469.1.89314 WP_000188469.1.89328 WP_000188469.1.89332 WP_000188469.1.89343 WP_000188469.1.89395 WP_000188469.1.8940 WP_000188469.1.89449 WP_000188469.1.8947 WP_000188469.1.89503 WP_000188469.1.89591 WP_000188469.1.89612 WP_000188469.1.89668 WP_000188469.1.89706 WP_000188469.1.89713 WP_000188469.1.89733 WP_000188469.1.89796 WP_000188469.1.89804 WP_000188469.1.89845 WP_000188469.1.89888 WP_000188469.1.89911 WP_000188469.1.8995 WP_000188469.1.89952 WP_000188469.1.90007 WP_000188469.1.9011 WP_000188469.1.90196 WP_000188469.1.90240 WP_000188469.1.90274 WP_000188469.1.90280 WP_000188469.1.90330 WP_000188469.1.90338 WP_000188469.1.90365 WP_000188469.1.90428 WP_000188469.1.90489 WP_000188469.1.90513 WP_000188469.1.90582 WP_000188469.1.90713 WP_000188469.1.90794 WP_000188469.1.90796 WP_000188469.1.90811 WP_000188469.1.9091 WP_000188469.1.91067 WP_000188469.1.91164 WP_000188469.1.91205 WP_000188469.1.91239 WP_000188469.1.91291 WP_000188469.1.91313 WP_000188469.1.9135 WP_000188469.1.91506 WP_000188469.1.91557 WP_000188469.1.91597 WP_000188469.1.91715 WP_000188469.1.9187 WP_000188469.1.91870 WP_000188469.1.92018 WP_000188469.1.92087 WP_000188469.1.92098 WP_000188469.1.92156 WP_000188469.1.92172 WP_000188469.1.92240 WP_000188469.1.92243 WP_000188469.1.92327 WP_000188469.1.92470 WP_000188469.1.92477 WP_000188469.1.92545 WP_000188469.1.92570 WP_000188469.1.92588 WP_000188469.1.926 WP_000188469.1.92633 WP_000188469.1.92649 WP_000188469.1.92676 WP_000188469.1.92705 WP_000188469.1.9271 WP_000188469.1.92734 WP_000188469.1.92810 WP_000188469.1.92823 WP_000188469.1.92987 WP_000188469.1.93007 WP_000188469.1.93022 WP_000188469.1.93103 WP_000188469.1.93105 WP_000188469.1.93111 WP_000188469.1.93121 WP_000188469.1.93168 WP_000188469.1.93184 WP_000188469.1.93221 WP_000188469.1.93223 WP_000188469.1.93239 WP_000188469.1.93302 WP_000188469.1.9336 WP_000188469.1.93387 WP_000188469.1.93469 WP_000188469.1.93511 WP_000188469.1.93512 WP_000188469.1.93635 WP_000188469.1.93657 WP_000188469.1.9374 WP_000188469.1.9375 WP_000188469.1.93754 WP_000188469.1.93780 WP_000188469.1.93828 WP_000188469.1.93842 WP_000188469.1.93843 WP_000188469.1.93875 WP_000188469.1.93909 WP_000188469.1.93919 WP_000188469.1.93938 WP_000188469.1.93984 WP_000188469.1.9399 WP_000188469.1.94017 WP_000188469.1.94079 WP_000188469.1.94097 WP_000188469.1.94107 WP_000188469.1.94142 WP_000188469.1.94215 WP_000188469.1.94303 WP_000188469.1.94365 WP_000188469.1.94390 WP_000188469.1.94415 WP_000188469.1.94492 WP_000188469.1.94510 WP_000188469.1.94527 WP_000188469.1.94573 WP_000188469.1.94579 WP_000188469.1.94586 WP_000188469.1.94593 WP_000188469.1.94650 WP_000188469.1.94659 WP_000188469.1.94662 WP_000188469.1.94700 WP_000188469.1.94745 WP_000188469.1.94782 WP_000188469.1.94815 WP_000188469.1.94820 WP_000188469.1.94850 WP_000188469.1.94851 WP_000188469.1.94864 WP_000188469.1.94952 WP_000188469.1.95006 WP_000188469.1.95055 WP_000188469.1.95076 WP_000188469.1.95099 WP_000188469.1.95165 WP_000188469.1.95239 WP_000188469.1.95246 WP_000188469.1.9525 WP_000188469.1.95255 WP_000188469.1.95265 WP_000188469.1.95338 WP_000188469.1.95412 WP_000188469.1.95530 WP_000188469.1.95547 WP_000188469.1.95590 WP_000188469.1.95625 WP_000188469.1.95675 WP_000188469.1.95716 WP_000188469.1.95776 WP_000188469.1.95884 WP_000188469.1.95890 WP_000188469.1.95906 WP_000188469.1.96025 WP_000188469.1.96044 WP_000188469.1.96054 WP_000188469.1.96094 WP_000188469.1.96127 WP_000188469.1.96144 WP_000188469.1.96188 WP_000188469.1.96211 WP_000188469.1.96212 WP_000188469.1.96319 WP_000188469.1.9633 WP_000188469.1.96359 WP_000188469.1.96539 WP_000188469.1.96552 WP_000188469.1.96610 WP_000188469.1.96625 WP_000188469.1.96635 WP_000188469.1.9664 WP_000188469.1.96675 WP_000188469.1.9670 WP_000188469.1.96750 WP_000188469.1.96792 WP_000188469.1.96801 WP_000188469.1.96803 WP_000188469.1.96925 WP_000188469.1.96938 WP_000188469.1.96946 WP_000188469.1.96957 WP_000188469.1.96978 WP_000188469.1.97026 WP_000188469.1.97028 WP_000188469.1.97079 WP_000188469.1.97154 WP_000188469.1.97184 WP_000188469.1.97287 WP_000188469.1.97291 WP_000188469.1.97422 WP_000188469.1.97441 WP_000188469.1.97497 WP_000188469.1.97505 WP_000188469.1.97599 WP_000188469.1.97606 WP_000188469.1.97615 WP_000188469.1.97646 WP_000188469.1.97690 WP_000188469.1.97819 WP_000188469.1.97840 WP_000188469.1.97938 WP_000188469.1.97986 WP_000188469.1.98036 WP_000188469.1.98080 WP_000188469.1.98086 WP_000188469.1.98158 WP_000188469.1.98263 WP_000188469.1.98418 WP_000188469.1.98448 WP_000188469.1.98457 WP_000188469.1.9850 WP_000188469.1.98502 WP_000188469.1.98607 WP_000188469.1.98731 WP_000188469.1.98762 WP_000188469.1.9877 WP_000188469.1.98801 WP_000188469.1.98818 WP_000188469.1.99163 WP_000188469.1.99335 WP_000188469.1.99350 WP_000188469.1.99360 WP_000188469.1.99363 WP_000188469.1.99369 WP_000188469.1.99388 WP_000188469.1.99397 WP_000188469.1.99463 WP_000188469.1.99483 WP_000188469.1.99546 WP_000188469.1.99579 WP_000188469.1.99595 WP_000188469.1.99671 WP_000188469.1.99676 WP_000188469.1.99764 WP_000188469.1.99829 WP_000188469.1.99837 WP_000188469.1.99841 WP_000188469.1.9992 WP_000188469.1.99996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]