SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16762601|ref|NP_458218.1| from Salmonella enterica subsp. enterica serovar Typhi str. CT18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16762601|ref|NP_458218.1|
Domain Number 1 Region: 4-396
Classification Level Classification E-value
Superfamily PLP-dependent transferases 9.65e-126
Family GABA-aminotransferase-like 0.00000000000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16762601|ref|NP_458218.1|
Sequence length 398
Comment 2-amino-3-ketobutyrate coenzyme A ligase [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
Sequence
MRGDFYKQLTNDLETARAEGLFKEERIITSAQQADITVADGSHVINFCANNYLGLANHPE
LINAAKAGMDSHGFGMASVRFICGTQDSHKALEQKLASFLGMEDAILYSSCFDANGGLFE
TLLGAEDAIISDALNHASIIDGVRLCKAKRYRYANNDMVELEARLKEAREAGARHVLIAT
DGVFSMDGVIANLKGVCDLADKYDALVMVDDSHAVGFVGENGRGSHEYCDVMGRVDIITG
TLGKALGGASGGYTAARKEVVEWLRQRSRPYLFSNSLAPAIVAASIKVLEMVEAGAELRD
RLWANARQFREQMSAAGFTLAGADHAIIPVMLGDAVVAQKFARELQKEGIYVTGFFYPVV
PKGQARIRTQMSAAHTPEQITRAVDAFTRIGKQLGVIA
Download sequence
Identical sequences A0A1S0ZP60 A0A2I6TF93 G5QRJ7 Q8Z2F5
gi|16762601|ref|NP_458218.1| gi|488656249|ref|YP_007928052.1| NP_458218.1.84458 WP_001213794.1.100008 WP_001213794.1.100036 WP_001213794.1.100079 WP_001213794.1.100196 WP_001213794.1.100284 WP_001213794.1.100313 WP_001213794.1.100314 WP_001213794.1.100321 WP_001213794.1.100354 WP_001213794.1.100421 WP_001213794.1.100446 WP_001213794.1.100450 WP_001213794.1.100592 WP_001213794.1.100610 WP_001213794.1.100732 WP_001213794.1.100733 WP_001213794.1.100739 WP_001213794.1.100764 WP_001213794.1.100799 WP_001213794.1.100941 WP_001213794.1.100953 WP_001213794.1.101011 WP_001213794.1.10108 WP_001213794.1.101226 WP_001213794.1.10124 WP_001213794.1.101271 WP_001213794.1.101312 WP_001213794.1.101322 WP_001213794.1.101374 WP_001213794.1.101616 WP_001213794.1.101724 WP_001213794.1.101890 WP_001213794.1.101941 WP_001213794.1.102050 WP_001213794.1.102087 WP_001213794.1.1038 WP_001213794.1.104 WP_001213794.1.10401 WP_001213794.1.10428 WP_001213794.1.10459 WP_001213794.1.10475 WP_001213794.1.10511 WP_001213794.1.10514 WP_001213794.1.10530 WP_001213794.1.10532 WP_001213794.1.10547 WP_001213794.1.10568 WP_001213794.1.10595 WP_001213794.1.10642 WP_001213794.1.10654 WP_001213794.1.10677 WP_001213794.1.10857 WP_001213794.1.10873 WP_001213794.1.10926 WP_001213794.1.10936 WP_001213794.1.11012 WP_001213794.1.11041 WP_001213794.1.11055 WP_001213794.1.11126 WP_001213794.1.11142 WP_001213794.1.11239 WP_001213794.1.11253 WP_001213794.1.113 WP_001213794.1.11314 WP_001213794.1.11385 WP_001213794.1.1142 WP_001213794.1.11426 WP_001213794.1.11429 WP_001213794.1.11557 WP_001213794.1.11567 WP_001213794.1.11638 WP_001213794.1.11883 WP_001213794.1.11908 WP_001213794.1.11914 WP_001213794.1.12040 WP_001213794.1.12061 WP_001213794.1.1207 WP_001213794.1.12141 WP_001213794.1.12172 WP_001213794.1.12192 WP_001213794.1.1224 WP_001213794.1.12364 WP_001213794.1.12398 WP_001213794.1.12441 WP_001213794.1.12581 WP_001213794.1.12620 WP_001213794.1.12648 WP_001213794.1.12683 WP_001213794.1.12726 WP_001213794.1.12727 WP_001213794.1.12741 WP_001213794.1.12834 WP_001213794.1.13108 WP_001213794.1.13161 WP_001213794.1.1321 WP_001213794.1.13268 WP_001213794.1.13291 WP_001213794.1.133 WP_001213794.1.13314 WP_001213794.1.13338 WP_001213794.1.13342 WP_001213794.1.13352 WP_001213794.1.13406 WP_001213794.1.13440 WP_001213794.1.13443 WP_001213794.1.13476 WP_001213794.1.13599 WP_001213794.1.13686 WP_001213794.1.1372 WP_001213794.1.13732 WP_001213794.1.1382 WP_001213794.1.1397 WP_001213794.1.13972 WP_001213794.1.140 WP_001213794.1.1401 WP_001213794.1.1408 WP_001213794.1.14089 WP_001213794.1.14099 WP_001213794.1.14120 WP_001213794.1.14123 WP_001213794.1.14150 WP_001213794.1.14191 WP_001213794.1.14197 WP_001213794.1.14280 WP_001213794.1.14333 WP_001213794.1.14399 WP_001213794.1.14444 WP_001213794.1.14467 WP_001213794.1.14474 WP_001213794.1.14500 WP_001213794.1.14526 WP_001213794.1.14550 WP_001213794.1.14575 WP_001213794.1.14701 WP_001213794.1.14703 WP_001213794.1.14719 WP_001213794.1.1473 WP_001213794.1.14765 WP_001213794.1.14810 WP_001213794.1.14877 WP_001213794.1.14894 WP_001213794.1.14930 WP_001213794.1.14947 WP_001213794.1.14948 WP_001213794.1.15184 WP_001213794.1.15244 WP_001213794.1.15265 WP_001213794.1.15362 WP_001213794.1.15415 WP_001213794.1.15423 WP_001213794.1.15439 WP_001213794.1.15487 WP_001213794.1.15535 WP_001213794.1.15581 WP_001213794.1.15597 WP_001213794.1.15710 WP_001213794.1.15717 WP_001213794.1.15905 WP_001213794.1.15912 WP_001213794.1.15970 WP_001213794.1.1601 WP_001213794.1.16046 WP_001213794.1.16051 WP_001213794.1.16058 WP_001213794.1.16150 WP_001213794.1.16155 WP_001213794.1.16201 WP_001213794.1.1626 WP_001213794.1.16264 WP_001213794.1.16344 WP_001213794.1.16452 WP_001213794.1.16461 WP_001213794.1.16462 WP_001213794.1.16465 WP_001213794.1.16522 WP_001213794.1.16588 WP_001213794.1.16658 WP_001213794.1.16666 WP_001213794.1.16673 WP_001213794.1.1674 WP_001213794.1.16767 WP_001213794.1.16781 WP_001213794.1.16879 WP_001213794.1.16893 WP_001213794.1.16905 WP_001213794.1.16948 WP_001213794.1.17049 WP_001213794.1.17058 WP_001213794.1.17078 WP_001213794.1.17202 WP_001213794.1.17219 WP_001213794.1.1722 WP_001213794.1.17302 WP_001213794.1.17308 WP_001213794.1.17368 WP_001213794.1.17405 WP_001213794.1.17406 WP_001213794.1.17513 WP_001213794.1.17543 WP_001213794.1.17563 WP_001213794.1.17578 WP_001213794.1.17622 WP_001213794.1.17659 WP_001213794.1.17667 WP_001213794.1.17686 WP_001213794.1.17741 WP_001213794.1.17840 WP_001213794.1.17956 WP_001213794.1.18005 WP_001213794.1.1801 WP_001213794.1.18021 WP_001213794.1.18099 WP_001213794.1.18124 WP_001213794.1.18144 WP_001213794.1.18173 WP_001213794.1.18270 WP_001213794.1.18280 WP_001213794.1.18328 WP_001213794.1.18358 WP_001213794.1.18370 WP_001213794.1.18406 WP_001213794.1.18474 WP_001213794.1.18513 WP_001213794.1.18610 WP_001213794.1.18678 WP_001213794.1.18722 WP_001213794.1.18766 WP_001213794.1.1880 WP_001213794.1.1885 WP_001213794.1.18860 WP_001213794.1.18895 WP_001213794.1.18922 WP_001213794.1.18959 WP_001213794.1.19001 WP_001213794.1.19006 WP_001213794.1.19044 WP_001213794.1.19084 WP_001213794.1.19187 WP_001213794.1.19228 WP_001213794.1.19288 WP_001213794.1.19300 WP_001213794.1.19422 WP_001213794.1.19454 WP_001213794.1.19456 WP_001213794.1.19496 WP_001213794.1.19535 WP_001213794.1.19538 WP_001213794.1.19589 WP_001213794.1.19663 WP_001213794.1.19686 WP_001213794.1.19731 WP_001213794.1.19794 WP_001213794.1.1990 WP_001213794.1.1992 WP_001213794.1.19970 WP_001213794.1.19999 WP_001213794.1.20254 WP_001213794.1.20255 WP_001213794.1.20296 WP_001213794.1.20339 WP_001213794.1.20419 WP_001213794.1.20465 WP_001213794.1.20492 WP_001213794.1.2053 WP_001213794.1.20635 WP_001213794.1.20718 WP_001213794.1.2073 WP_001213794.1.20740 WP_001213794.1.20828 WP_001213794.1.2087 WP_001213794.1.20883 WP_001213794.1.20947 WP_001213794.1.20953 WP_001213794.1.21010 WP_001213794.1.2106 WP_001213794.1.21062 WP_001213794.1.21144 WP_001213794.1.21162 WP_001213794.1.21181 WP_001213794.1.21184 WP_001213794.1.21185 WP_001213794.1.21366 WP_001213794.1.21492 WP_001213794.1.2166 WP_001213794.1.21674 WP_001213794.1.21946 WP_001213794.1.21966 WP_001213794.1.22064 WP_001213794.1.22118 WP_001213794.1.22126 WP_001213794.1.2216 WP_001213794.1.22208 WP_001213794.1.2227 WP_001213794.1.22373 WP_001213794.1.22476 WP_001213794.1.22582 WP_001213794.1.22652 WP_001213794.1.22683 WP_001213794.1.2284 WP_001213794.1.22845 WP_001213794.1.22855 WP_001213794.1.22895 WP_001213794.1.22926 WP_001213794.1.22943 WP_001213794.1.22967 WP_001213794.1.23040 WP_001213794.1.23058 WP_001213794.1.23218 WP_001213794.1.2331 WP_001213794.1.2332 WP_001213794.1.23340 WP_001213794.1.2336 WP_001213794.1.23365 WP_001213794.1.23412 WP_001213794.1.23426 WP_001213794.1.23492 WP_001213794.1.23515 WP_001213794.1.23548 WP_001213794.1.23571 WP_001213794.1.23604 WP_001213794.1.23679 WP_001213794.1.23728 WP_001213794.1.2375 WP_001213794.1.2376 WP_001213794.1.23783 WP_001213794.1.23786 WP_001213794.1.23787 WP_001213794.1.23801 WP_001213794.1.24028 WP_001213794.1.24061 WP_001213794.1.24083 WP_001213794.1.24117 WP_001213794.1.24125 WP_001213794.1.24138 WP_001213794.1.24153 WP_001213794.1.24291 WP_001213794.1.24322 WP_001213794.1.24355 WP_001213794.1.24375 WP_001213794.1.24392 WP_001213794.1.24400 WP_001213794.1.24420 WP_001213794.1.24619 WP_001213794.1.24643 WP_001213794.1.24688 WP_001213794.1.24716 WP_001213794.1.24727 WP_001213794.1.2481 WP_001213794.1.24832 WP_001213794.1.24964 WP_001213794.1.25017 WP_001213794.1.25032 WP_001213794.1.25041 WP_001213794.1.25053 WP_001213794.1.25140 WP_001213794.1.25185 WP_001213794.1.25196 WP_001213794.1.25210 WP_001213794.1.25219 WP_001213794.1.25304 WP_001213794.1.25374 WP_001213794.1.25475 WP_001213794.1.25490 WP_001213794.1.25508 WP_001213794.1.25512 WP_001213794.1.25596 WP_001213794.1.25603 WP_001213794.1.2562 WP_001213794.1.25666 WP_001213794.1.25807 WP_001213794.1.25821 WP_001213794.1.25833 WP_001213794.1.25835 WP_001213794.1.25882 WP_001213794.1.25911 WP_001213794.1.25962 WP_001213794.1.25963 WP_001213794.1.26001 WP_001213794.1.26027 WP_001213794.1.26107 WP_001213794.1.2615 WP_001213794.1.26217 WP_001213794.1.26230 WP_001213794.1.26232 WP_001213794.1.26272 WP_001213794.1.26286 WP_001213794.1.26288 WP_001213794.1.26394 WP_001213794.1.26491 WP_001213794.1.2654 WP_001213794.1.26554 WP_001213794.1.26636 WP_001213794.1.26689 WP_001213794.1.2679 WP_001213794.1.26908 WP_001213794.1.2692 WP_001213794.1.26928 WP_001213794.1.270 WP_001213794.1.27008 WP_001213794.1.27027 WP_001213794.1.27070 WP_001213794.1.27077 WP_001213794.1.27086 WP_001213794.1.27087 WP_001213794.1.27111 WP_001213794.1.27115 WP_001213794.1.2713 WP_001213794.1.27169 WP_001213794.1.2717 WP_001213794.1.27228 WP_001213794.1.27282 WP_001213794.1.27285 WP_001213794.1.27309 WP_001213794.1.27329 WP_001213794.1.27342 WP_001213794.1.27361 WP_001213794.1.27513 WP_001213794.1.27565 WP_001213794.1.27595 WP_001213794.1.27598 WP_001213794.1.27616 WP_001213794.1.27706 WP_001213794.1.27775 WP_001213794.1.27785 WP_001213794.1.27900 WP_001213794.1.27928 WP_001213794.1.27945 WP_001213794.1.28004 WP_001213794.1.2809 WP_001213794.1.28155 WP_001213794.1.28198 WP_001213794.1.2822 WP_001213794.1.28229 WP_001213794.1.2825 WP_001213794.1.28384 WP_001213794.1.28386 WP_001213794.1.28395 WP_001213794.1.284 WP_001213794.1.2845 WP_001213794.1.28479 WP_001213794.1.28627 WP_001213794.1.28692 WP_001213794.1.2873 WP_001213794.1.28917 WP_001213794.1.28962 WP_001213794.1.29023 WP_001213794.1.29042 WP_001213794.1.2905 WP_001213794.1.2907 WP_001213794.1.29081 WP_001213794.1.29089 WP_001213794.1.29153 WP_001213794.1.29203 WP_001213794.1.29237 WP_001213794.1.29248 WP_001213794.1.29288 WP_001213794.1.29389 WP_001213794.1.29439 WP_001213794.1.2946 WP_001213794.1.29462 WP_001213794.1.29563 WP_001213794.1.29727 WP_001213794.1.29743 WP_001213794.1.29782 WP_001213794.1.29833 WP_001213794.1.29851 WP_001213794.1.29865 WP_001213794.1.29886 WP_001213794.1.29919 WP_001213794.1.29923 WP_001213794.1.2994 WP_001213794.1.29964 WP_001213794.1.29983 WP_001213794.1.30009 WP_001213794.1.30013 WP_001213794.1.3002 WP_001213794.1.30034 WP_001213794.1.30049 WP_001213794.1.30058 WP_001213794.1.30172 WP_001213794.1.30185 WP_001213794.1.30354 WP_001213794.1.30357 WP_001213794.1.30362 WP_001213794.1.30389 WP_001213794.1.3042 WP_001213794.1.30421 WP_001213794.1.30440 WP_001213794.1.30448 WP_001213794.1.30489 WP_001213794.1.30517 WP_001213794.1.30542 WP_001213794.1.30544 WP_001213794.1.30556 WP_001213794.1.30572 WP_001213794.1.30585 WP_001213794.1.30618 WP_001213794.1.30664 WP_001213794.1.30688 WP_001213794.1.30806 WP_001213794.1.30967 WP_001213794.1.31046 WP_001213794.1.31066 WP_001213794.1.31078 WP_001213794.1.31111 WP_001213794.1.31139 WP_001213794.1.31145 WP_001213794.1.31182 WP_001213794.1.31205 WP_001213794.1.3121 WP_001213794.1.31223 WP_001213794.1.31303 WP_001213794.1.3131 WP_001213794.1.31352 WP_001213794.1.31389 WP_001213794.1.31413 WP_001213794.1.31446 WP_001213794.1.31533 WP_001213794.1.31799 WP_001213794.1.31836 WP_001213794.1.31845 WP_001213794.1.31854 WP_001213794.1.31951 WP_001213794.1.32038 WP_001213794.1.32041 WP_001213794.1.32042 WP_001213794.1.32054 WP_001213794.1.3207 WP_001213794.1.32189 WP_001213794.1.32202 WP_001213794.1.32263 WP_001213794.1.32293 WP_001213794.1.32299 WP_001213794.1.32408 WP_001213794.1.32422 WP_001213794.1.32425 WP_001213794.1.32458 WP_001213794.1.32459 WP_001213794.1.32460 WP_001213794.1.32529 WP_001213794.1.32563 WP_001213794.1.32578 WP_001213794.1.32617 WP_001213794.1.3270 WP_001213794.1.32725 WP_001213794.1.32838 WP_001213794.1.32848 WP_001213794.1.32868 WP_001213794.1.3290 WP_001213794.1.32902 WP_001213794.1.32940 WP_001213794.1.32941 WP_001213794.1.3296 WP_001213794.1.32966 WP_001213794.1.32985 WP_001213794.1.33037 WP_001213794.1.3305 WP_001213794.1.33051 WP_001213794.1.33065 WP_001213794.1.33122 WP_001213794.1.3315 WP_001213794.1.33208 WP_001213794.1.33214 WP_001213794.1.33247 WP_001213794.1.33280 WP_001213794.1.33283 WP_001213794.1.33313 WP_001213794.1.33339 WP_001213794.1.33382 WP_001213794.1.33490 WP_001213794.1.33501 WP_001213794.1.33529 WP_001213794.1.33689 WP_001213794.1.3370 WP_001213794.1.33730 WP_001213794.1.33741 WP_001213794.1.33840 WP_001213794.1.3392 WP_001213794.1.33926 WP_001213794.1.33957 WP_001213794.1.33969 WP_001213794.1.34001 WP_001213794.1.34059 WP_001213794.1.34118 WP_001213794.1.34211 WP_001213794.1.34214 WP_001213794.1.34234 WP_001213794.1.34284 WP_001213794.1.34376 WP_001213794.1.34382 WP_001213794.1.34484 WP_001213794.1.34517 WP_001213794.1.34530 WP_001213794.1.34647 WP_001213794.1.34665 WP_001213794.1.34694 WP_001213794.1.34751 WP_001213794.1.34808 WP_001213794.1.34824 WP_001213794.1.34834 WP_001213794.1.34932 WP_001213794.1.34962 WP_001213794.1.35001 WP_001213794.1.35040 WP_001213794.1.35074 WP_001213794.1.35125 WP_001213794.1.35175 WP_001213794.1.35240 WP_001213794.1.35274 WP_001213794.1.35294 WP_001213794.1.35532 WP_001213794.1.35560 WP_001213794.1.3557 WP_001213794.1.35628 WP_001213794.1.3570 WP_001213794.1.35712 WP_001213794.1.35713 WP_001213794.1.35736 WP_001213794.1.35791 WP_001213794.1.35795 WP_001213794.1.35870 WP_001213794.1.35916 WP_001213794.1.35938 WP_001213794.1.35966 WP_001213794.1.36000 WP_001213794.1.36034 WP_001213794.1.36036 WP_001213794.1.36069 WP_001213794.1.36291 WP_001213794.1.36298 WP_001213794.1.36308 WP_001213794.1.36323 WP_001213794.1.36343 WP_001213794.1.36460 WP_001213794.1.3649 WP_001213794.1.36495 WP_001213794.1.36526 WP_001213794.1.36564 WP_001213794.1.36567 WP_001213794.1.36579 WP_001213794.1.36617 WP_001213794.1.36618 WP_001213794.1.36643 WP_001213794.1.36663 WP_001213794.1.36701 WP_001213794.1.36725 WP_001213794.1.36779 WP_001213794.1.36798 WP_001213794.1.36802 WP_001213794.1.36821 WP_001213794.1.36853 WP_001213794.1.36950 WP_001213794.1.36978 WP_001213794.1.37014 WP_001213794.1.37133 WP_001213794.1.37176 WP_001213794.1.37199 WP_001213794.1.37200 WP_001213794.1.37258 WP_001213794.1.37303 WP_001213794.1.37513 WP_001213794.1.37584 WP_001213794.1.37590 WP_001213794.1.37593 WP_001213794.1.37600 WP_001213794.1.37613 WP_001213794.1.37659 WP_001213794.1.37662 WP_001213794.1.37675 WP_001213794.1.37691 WP_001213794.1.37761 WP_001213794.1.37775 WP_001213794.1.37777 WP_001213794.1.378 WP_001213794.1.379 WP_001213794.1.37911 WP_001213794.1.37941 WP_001213794.1.37985 WP_001213794.1.38061 WP_001213794.1.38064 WP_001213794.1.38108 WP_001213794.1.3816 WP_001213794.1.38207 WP_001213794.1.38261 WP_001213794.1.38266 WP_001213794.1.38310 WP_001213794.1.3834 WP_001213794.1.38351 WP_001213794.1.3838 WP_001213794.1.38381 WP_001213794.1.38440 WP_001213794.1.38486 WP_001213794.1.38515 WP_001213794.1.38595 WP_001213794.1.3860 WP_001213794.1.38642 WP_001213794.1.38734 WP_001213794.1.38877 WP_001213794.1.38881 WP_001213794.1.38895 WP_001213794.1.38983 WP_001213794.1.38996 WP_001213794.1.39056 WP_001213794.1.3907 WP_001213794.1.39105 WP_001213794.1.3914 WP_001213794.1.39147 WP_001213794.1.39161 WP_001213794.1.39210 WP_001213794.1.39235 WP_001213794.1.3931 WP_001213794.1.39435 WP_001213794.1.39502 WP_001213794.1.39530 WP_001213794.1.39619 WP_001213794.1.39620 WP_001213794.1.39624 WP_001213794.1.39659 WP_001213794.1.39667 WP_001213794.1.39775 WP_001213794.1.39879 WP_001213794.1.39890 WP_001213794.1.39941 WP_001213794.1.39945 WP_001213794.1.39947 WP_001213794.1.40095 WP_001213794.1.40097 WP_001213794.1.401 WP_001213794.1.40160 WP_001213794.1.40167 WP_001213794.1.40279 WP_001213794.1.40361 WP_001213794.1.4042 WP_001213794.1.40467 WP_001213794.1.40496 WP_001213794.1.40517 WP_001213794.1.40698 WP_001213794.1.40750 WP_001213794.1.40763 WP_001213794.1.40854 WP_001213794.1.4088 WP_001213794.1.4089 WP_001213794.1.40924 WP_001213794.1.40932 WP_001213794.1.40946 WP_001213794.1.41004 WP_001213794.1.4106 WP_001213794.1.41070 WP_001213794.1.41074 WP_001213794.1.41075 WP_001213794.1.41097 WP_001213794.1.41132 WP_001213794.1.41176 WP_001213794.1.41251 WP_001213794.1.41258 WP_001213794.1.41305 WP_001213794.1.41321 WP_001213794.1.41333 WP_001213794.1.41335 WP_001213794.1.41345 WP_001213794.1.4136 WP_001213794.1.41415 WP_001213794.1.41459 WP_001213794.1.41498 WP_001213794.1.41519 WP_001213794.1.41524 WP_001213794.1.41631 WP_001213794.1.41658 WP_001213794.1.41659 WP_001213794.1.41716 WP_001213794.1.41746 WP_001213794.1.41824 WP_001213794.1.41825 WP_001213794.1.41836 WP_001213794.1.41894 WP_001213794.1.41919 WP_001213794.1.41929 WP_001213794.1.4194 WP_001213794.1.42069 WP_001213794.1.42081 WP_001213794.1.42090 WP_001213794.1.42111 WP_001213794.1.42187 WP_001213794.1.42200 WP_001213794.1.42219 WP_001213794.1.42257 WP_001213794.1.42261 WP_001213794.1.42349 WP_001213794.1.42364 WP_001213794.1.42371 WP_001213794.1.42379 WP_001213794.1.42391 WP_001213794.1.42399 WP_001213794.1.42539 WP_001213794.1.42603 WP_001213794.1.42650 WP_001213794.1.4267 WP_001213794.1.42701 WP_001213794.1.42805 WP_001213794.1.42815 WP_001213794.1.42859 WP_001213794.1.4298 WP_001213794.1.43008 WP_001213794.1.43016 WP_001213794.1.43019 WP_001213794.1.43065 WP_001213794.1.43068 WP_001213794.1.43069 WP_001213794.1.43126 WP_001213794.1.43128 WP_001213794.1.43141 WP_001213794.1.43157 WP_001213794.1.43161 WP_001213794.1.43190 WP_001213794.1.43198 WP_001213794.1.4326 WP_001213794.1.43290 WP_001213794.1.43292 WP_001213794.1.43307 WP_001213794.1.43513 WP_001213794.1.43633 WP_001213794.1.43637 WP_001213794.1.43651 WP_001213794.1.43722 WP_001213794.1.43801 WP_001213794.1.43812 WP_001213794.1.43878 WP_001213794.1.43888 WP_001213794.1.43919 WP_001213794.1.43974 WP_001213794.1.44049 WP_001213794.1.44101 WP_001213794.1.44160 WP_001213794.1.44180 WP_001213794.1.44196 WP_001213794.1.44248 WP_001213794.1.44262 WP_001213794.1.44268 WP_001213794.1.4427 WP_001213794.1.44296 WP_001213794.1.44343 WP_001213794.1.44351 WP_001213794.1.44360 WP_001213794.1.44416 WP_001213794.1.44431 WP_001213794.1.44437 WP_001213794.1.44546 WP_001213794.1.4468 WP_001213794.1.44762 WP_001213794.1.44815 WP_001213794.1.44828 WP_001213794.1.44879 WP_001213794.1.44917 WP_001213794.1.4501 WP_001213794.1.45072 WP_001213794.1.45093 WP_001213794.1.45136 WP_001213794.1.45241 WP_001213794.1.45435 WP_001213794.1.45523 WP_001213794.1.45596 WP_001213794.1.45648 WP_001213794.1.45829 WP_001213794.1.45871 WP_001213794.1.46030 WP_001213794.1.46077 WP_001213794.1.46169 WP_001213794.1.46225 WP_001213794.1.46241 WP_001213794.1.46307 WP_001213794.1.46355 WP_001213794.1.464 WP_001213794.1.46454 WP_001213794.1.46461 WP_001213794.1.46504 WP_001213794.1.46505 WP_001213794.1.46551 WP_001213794.1.46559 WP_001213794.1.46701 WP_001213794.1.46781 WP_001213794.1.46816 WP_001213794.1.46842 WP_001213794.1.4690 WP_001213794.1.46920 WP_001213794.1.46945 WP_001213794.1.47036 WP_001213794.1.47037 WP_001213794.1.47042 WP_001213794.1.47059 WP_001213794.1.47085 WP_001213794.1.47123 WP_001213794.1.47215 WP_001213794.1.47245 WP_001213794.1.47523 WP_001213794.1.47531 WP_001213794.1.47532 WP_001213794.1.47605 WP_001213794.1.47630 WP_001213794.1.47714 WP_001213794.1.4774 WP_001213794.1.47756 WP_001213794.1.4781 WP_001213794.1.47817 WP_001213794.1.47886 WP_001213794.1.47898 WP_001213794.1.48019 WP_001213794.1.48100 WP_001213794.1.48114 WP_001213794.1.48139 WP_001213794.1.48190 WP_001213794.1.48292 WP_001213794.1.48324 WP_001213794.1.48426 WP_001213794.1.48430 WP_001213794.1.48436 WP_001213794.1.48586 WP_001213794.1.4859 WP_001213794.1.48591 WP_001213794.1.48610 WP_001213794.1.48631 WP_001213794.1.48663 WP_001213794.1.48690 WP_001213794.1.48734 WP_001213794.1.48756 WP_001213794.1.48778 WP_001213794.1.48849 WP_001213794.1.48955 WP_001213794.1.48963 WP_001213794.1.48973 WP_001213794.1.49004 WP_001213794.1.49106 WP_001213794.1.49117 WP_001213794.1.49121 WP_001213794.1.4914 WP_001213794.1.49140 WP_001213794.1.49153 WP_001213794.1.49166 WP_001213794.1.49355 WP_001213794.1.49429 WP_001213794.1.49434 WP_001213794.1.49450 WP_001213794.1.495 WP_001213794.1.49545 WP_001213794.1.49703 WP_001213794.1.49769 WP_001213794.1.49846 WP_001213794.1.4991 WP_001213794.1.49947 WP_001213794.1.49959 WP_001213794.1.49997 WP_001213794.1.50014 WP_001213794.1.50030 WP_001213794.1.50043 WP_001213794.1.50103 WP_001213794.1.50158 WP_001213794.1.50247 WP_001213794.1.50308 WP_001213794.1.50309 WP_001213794.1.50387 WP_001213794.1.50406 WP_001213794.1.50468 WP_001213794.1.5051 WP_001213794.1.50566 WP_001213794.1.50570 WP_001213794.1.50626 WP_001213794.1.50726 WP_001213794.1.50771 WP_001213794.1.50875 WP_001213794.1.50885 WP_001213794.1.509 WP_001213794.1.50929 WP_001213794.1.50970 WP_001213794.1.51040 WP_001213794.1.51048 WP_001213794.1.51100 WP_001213794.1.51134 WP_001213794.1.51227 WP_001213794.1.5127 WP_001213794.1.51305 WP_001213794.1.51315 WP_001213794.1.5136 WP_001213794.1.51474 WP_001213794.1.51519 WP_001213794.1.51598 WP_001213794.1.51644 WP_001213794.1.51724 WP_001213794.1.51734 WP_001213794.1.51838 WP_001213794.1.51863 WP_001213794.1.51935 WP_001213794.1.52057 WP_001213794.1.52114 WP_001213794.1.52129 WP_001213794.1.52156 WP_001213794.1.52191 WP_001213794.1.52202 WP_001213794.1.52209 WP_001213794.1.52339 WP_001213794.1.52469 WP_001213794.1.52571 WP_001213794.1.526 WP_001213794.1.52647 WP_001213794.1.52742 WP_001213794.1.52773 WP_001213794.1.52795 WP_001213794.1.52807 WP_001213794.1.52887 WP_001213794.1.5301 WP_001213794.1.53092 WP_001213794.1.53141 WP_001213794.1.53151 WP_001213794.1.53154 WP_001213794.1.53159 WP_001213794.1.53210 WP_001213794.1.53233 WP_001213794.1.53274 WP_001213794.1.53307 WP_001213794.1.53321 WP_001213794.1.53368 WP_001213794.1.53375 WP_001213794.1.53450 WP_001213794.1.5349 WP_001213794.1.53540 WP_001213794.1.53555 WP_001213794.1.53559 WP_001213794.1.5356 WP_001213794.1.53571 WP_001213794.1.5358 WP_001213794.1.53692 WP_001213794.1.53723 WP_001213794.1.5374 WP_001213794.1.53750 WP_001213794.1.53800 WP_001213794.1.53815 WP_001213794.1.53839 WP_001213794.1.53892 WP_001213794.1.53898 WP_001213794.1.53902 WP_001213794.1.53958 WP_001213794.1.53981 WP_001213794.1.53984 WP_001213794.1.54132 WP_001213794.1.54170 WP_001213794.1.54175 WP_001213794.1.54203 WP_001213794.1.54259 WP_001213794.1.5430 WP_001213794.1.54371 WP_001213794.1.54431 WP_001213794.1.54442 WP_001213794.1.54482 WP_001213794.1.54589 WP_001213794.1.54667 WP_001213794.1.54678 WP_001213794.1.54681 WP_001213794.1.54748 WP_001213794.1.5481 WP_001213794.1.54865 WP_001213794.1.54935 WP_001213794.1.54979 WP_001213794.1.55010 WP_001213794.1.55034 WP_001213794.1.55163 WP_001213794.1.55165 WP_001213794.1.55215 WP_001213794.1.55290 WP_001213794.1.55310 WP_001213794.1.55317 WP_001213794.1.55379 WP_001213794.1.5539 WP_001213794.1.55468 WP_001213794.1.55506 WP_001213794.1.55604 WP_001213794.1.55639 WP_001213794.1.55699 WP_001213794.1.55725 WP_001213794.1.55780 WP_001213794.1.55967 WP_001213794.1.56144 WP_001213794.1.56172 WP_001213794.1.5621 WP_001213794.1.56226 WP_001213794.1.56311 WP_001213794.1.56368 WP_001213794.1.56419 WP_001213794.1.56423 WP_001213794.1.56514 WP_001213794.1.56535 WP_001213794.1.56585 WP_001213794.1.56640 WP_001213794.1.56724 WP_001213794.1.56825 WP_001213794.1.56887 WP_001213794.1.56889 WP_001213794.1.56981 WP_001213794.1.57101 WP_001213794.1.57137 WP_001213794.1.57147 WP_001213794.1.57179 WP_001213794.1.57186 WP_001213794.1.57342 WP_001213794.1.57684 WP_001213794.1.57699 WP_001213794.1.57735 WP_001213794.1.57785 WP_001213794.1.57800 WP_001213794.1.57873 WP_001213794.1.57965 WP_001213794.1.57972 WP_001213794.1.58008 WP_001213794.1.58044 WP_001213794.1.58081 WP_001213794.1.5809 WP_001213794.1.58132 WP_001213794.1.58157 WP_001213794.1.58173 WP_001213794.1.58191 WP_001213794.1.58194 WP_001213794.1.58252 WP_001213794.1.58261 WP_001213794.1.58274 WP_001213794.1.58282 WP_001213794.1.58324 WP_001213794.1.58326 WP_001213794.1.5836 WP_001213794.1.58485 WP_001213794.1.58537 WP_001213794.1.58568 WP_001213794.1.58583 WP_001213794.1.58652 WP_001213794.1.58663 WP_001213794.1.58724 WP_001213794.1.5875 WP_001213794.1.58796 WP_001213794.1.58807 WP_001213794.1.58847 WP_001213794.1.58883 WP_001213794.1.58898 WP_001213794.1.58949 WP_001213794.1.58963 WP_001213794.1.58970 WP_001213794.1.58974 WP_001213794.1.59020 WP_001213794.1.59043 WP_001213794.1.59056 WP_001213794.1.59061 WP_001213794.1.59064 WP_001213794.1.59097 WP_001213794.1.59125 WP_001213794.1.59282 WP_001213794.1.59299 WP_001213794.1.59313 WP_001213794.1.5949 WP_001213794.1.59501 WP_001213794.1.59510 WP_001213794.1.59512 WP_001213794.1.59562 WP_001213794.1.5969 WP_001213794.1.59751 WP_001213794.1.59827 WP_001213794.1.59829 WP_001213794.1.59847 WP_001213794.1.59863 WP_001213794.1.59969 WP_001213794.1.59994 WP_001213794.1.60045 WP_001213794.1.60076 WP_001213794.1.60114 WP_001213794.1.60154 WP_001213794.1.60168 WP_001213794.1.60192 WP_001213794.1.60199 WP_001213794.1.60212 WP_001213794.1.60253 WP_001213794.1.60322 WP_001213794.1.60324 WP_001213794.1.60356 WP_001213794.1.6038 WP_001213794.1.60380 WP_001213794.1.6041 WP_001213794.1.60424 WP_001213794.1.60481 WP_001213794.1.605 WP_001213794.1.6058 WP_001213794.1.60584 WP_001213794.1.6060 WP_001213794.1.60608 WP_001213794.1.60676 WP_001213794.1.60708 WP_001213794.1.60725 WP_001213794.1.60783 WP_001213794.1.60792 WP_001213794.1.60807 WP_001213794.1.60882 WP_001213794.1.60889 WP_001213794.1.60950 WP_001213794.1.6104 WP_001213794.1.61044 WP_001213794.1.61076 WP_001213794.1.6108 WP_001213794.1.61123 WP_001213794.1.61147 WP_001213794.1.61168 WP_001213794.1.61200 WP_001213794.1.61210 WP_001213794.1.61357 WP_001213794.1.61434 WP_001213794.1.61509 WP_001213794.1.61511 WP_001213794.1.61539 WP_001213794.1.61542 WP_001213794.1.61553 WP_001213794.1.61649 WP_001213794.1.61652 WP_001213794.1.61697 WP_001213794.1.61809 WP_001213794.1.61877 WP_001213794.1.61920 WP_001213794.1.62124 WP_001213794.1.62199 WP_001213794.1.62222 WP_001213794.1.62223 WP_001213794.1.62302 WP_001213794.1.62314 WP_001213794.1.62323 WP_001213794.1.62333 WP_001213794.1.62338 WP_001213794.1.62380 WP_001213794.1.62411 WP_001213794.1.62436 WP_001213794.1.62475 WP_001213794.1.62488 WP_001213794.1.62536 WP_001213794.1.62640 WP_001213794.1.62686 WP_001213794.1.62751 WP_001213794.1.62825 WP_001213794.1.62913 WP_001213794.1.62932 WP_001213794.1.62960 WP_001213794.1.63016 WP_001213794.1.63025 WP_001213794.1.63069 WP_001213794.1.63087 WP_001213794.1.63150 WP_001213794.1.63169 WP_001213794.1.63297 WP_001213794.1.63448 WP_001213794.1.63514 WP_001213794.1.63583 WP_001213794.1.63592 WP_001213794.1.63663 WP_001213794.1.63736 WP_001213794.1.63766 WP_001213794.1.63816 WP_001213794.1.63876 WP_001213794.1.6389 WP_001213794.1.63901 WP_001213794.1.63955 WP_001213794.1.63963 WP_001213794.1.64032 WP_001213794.1.64087 WP_001213794.1.6415 WP_001213794.1.64293 WP_001213794.1.64332 WP_001213794.1.64376 WP_001213794.1.644 WP_001213794.1.64471 WP_001213794.1.64501 WP_001213794.1.64538 WP_001213794.1.64632 WP_001213794.1.64648 WP_001213794.1.64654 WP_001213794.1.64662 WP_001213794.1.64663 WP_001213794.1.64709 WP_001213794.1.64710 WP_001213794.1.64744 WP_001213794.1.64763 WP_001213794.1.64817 WP_001213794.1.64847 WP_001213794.1.6487 WP_001213794.1.64891 WP_001213794.1.64974 WP_001213794.1.65054 WP_001213794.1.65075 WP_001213794.1.6514 WP_001213794.1.65172 WP_001213794.1.65191 WP_001213794.1.65200 WP_001213794.1.65211 WP_001213794.1.65218 WP_001213794.1.65226 WP_001213794.1.65249 WP_001213794.1.65266 WP_001213794.1.65395 WP_001213794.1.65459 WP_001213794.1.65463 WP_001213794.1.65487 WP_001213794.1.6549 WP_001213794.1.65499 WP_001213794.1.6554 WP_001213794.1.65650 WP_001213794.1.65697 WP_001213794.1.65699 WP_001213794.1.65737 WP_001213794.1.65755 WP_001213794.1.65812 WP_001213794.1.65846 WP_001213794.1.65863 WP_001213794.1.65985 WP_001213794.1.66021 WP_001213794.1.66031 WP_001213794.1.66052 WP_001213794.1.66064 WP_001213794.1.66109 WP_001213794.1.66145 WP_001213794.1.66183 WP_001213794.1.6620 WP_001213794.1.66216 WP_001213794.1.66234 WP_001213794.1.66273 WP_001213794.1.66324 WP_001213794.1.6634 WP_001213794.1.66361 WP_001213794.1.66480 WP_001213794.1.66506 WP_001213794.1.66665 WP_001213794.1.66681 WP_001213794.1.66684 WP_001213794.1.66755 WP_001213794.1.66759 WP_001213794.1.66801 WP_001213794.1.66860 WP_001213794.1.66953 WP_001213794.1.66955 WP_001213794.1.66981 WP_001213794.1.67024 WP_001213794.1.67042 WP_001213794.1.67101 WP_001213794.1.67143 WP_001213794.1.67201 WP_001213794.1.67211 WP_001213794.1.67237 WP_001213794.1.67336 WP_001213794.1.67339 WP_001213794.1.67387 WP_001213794.1.67394 WP_001213794.1.67397 WP_001213794.1.67403 WP_001213794.1.67430 WP_001213794.1.67442 WP_001213794.1.67539 WP_001213794.1.67556 WP_001213794.1.67576 WP_001213794.1.67604 WP_001213794.1.67619 WP_001213794.1.67625 WP_001213794.1.67627 WP_001213794.1.67641 WP_001213794.1.67657 WP_001213794.1.67673 WP_001213794.1.67700 WP_001213794.1.67718 WP_001213794.1.67729 WP_001213794.1.67774 WP_001213794.1.67820 WP_001213794.1.67910 WP_001213794.1.67954 WP_001213794.1.68 WP_001213794.1.68043 WP_001213794.1.68075 WP_001213794.1.68105 WP_001213794.1.68113 WP_001213794.1.68131 WP_001213794.1.68182 WP_001213794.1.6819 WP_001213794.1.68285 WP_001213794.1.68359 WP_001213794.1.68420 WP_001213794.1.68514 WP_001213794.1.68564 WP_001213794.1.68688 WP_001213794.1.68690 WP_001213794.1.68742 WP_001213794.1.68770 WP_001213794.1.68809 WP_001213794.1.68914 WP_001213794.1.68958 WP_001213794.1.69053 WP_001213794.1.69170 WP_001213794.1.69210 WP_001213794.1.69270 WP_001213794.1.69282 WP_001213794.1.69346 WP_001213794.1.69376 WP_001213794.1.69396 WP_001213794.1.69466 WP_001213794.1.69611 WP_001213794.1.69642 WP_001213794.1.69656 WP_001213794.1.69657 WP_001213794.1.69690 WP_001213794.1.69923 WP_001213794.1.69948 WP_001213794.1.69953 WP_001213794.1.70010 WP_001213794.1.70049 WP_001213794.1.70058 WP_001213794.1.70061 WP_001213794.1.70205 WP_001213794.1.70240 WP_001213794.1.70249 WP_001213794.1.70261 WP_001213794.1.70314 WP_001213794.1.7033 WP_001213794.1.70427 WP_001213794.1.70433 WP_001213794.1.70545 WP_001213794.1.70623 WP_001213794.1.70671 WP_001213794.1.70679 WP_001213794.1.70708 WP_001213794.1.70717 WP_001213794.1.70731 WP_001213794.1.70772 WP_001213794.1.70845 WP_001213794.1.70846 WP_001213794.1.70981 WP_001213794.1.70995 WP_001213794.1.71010 WP_001213794.1.71039 WP_001213794.1.71057 WP_001213794.1.71081 WP_001213794.1.71117 WP_001213794.1.71186 WP_001213794.1.71455 WP_001213794.1.71456 WP_001213794.1.71487 WP_001213794.1.71523 WP_001213794.1.71542 WP_001213794.1.71566 WP_001213794.1.71640 WP_001213794.1.71651 WP_001213794.1.71653 WP_001213794.1.71716 WP_001213794.1.71872 WP_001213794.1.71950 WP_001213794.1.71954 WP_001213794.1.71985 WP_001213794.1.72003 WP_001213794.1.72073 WP_001213794.1.72107 WP_001213794.1.72269 WP_001213794.1.72350 WP_001213794.1.72351 WP_001213794.1.72383 WP_001213794.1.72461 WP_001213794.1.72527 WP_001213794.1.7255 WP_001213794.1.72631 WP_001213794.1.72638 WP_001213794.1.72667 WP_001213794.1.72674 WP_001213794.1.72724 WP_001213794.1.72789 WP_001213794.1.72828 WP_001213794.1.72896 WP_001213794.1.72969 WP_001213794.1.72987 WP_001213794.1.73052 WP_001213794.1.7311 WP_001213794.1.73114 WP_001213794.1.7316 WP_001213794.1.73177 WP_001213794.1.73180 WP_001213794.1.73258 WP_001213794.1.73285 WP_001213794.1.7332 WP_001213794.1.7333 WP_001213794.1.73352 WP_001213794.1.73389 WP_001213794.1.73425 WP_001213794.1.73488 WP_001213794.1.73504 WP_001213794.1.7353 WP_001213794.1.73544 WP_001213794.1.73598 WP_001213794.1.7361 WP_001213794.1.73648 WP_001213794.1.73768 WP_001213794.1.73849 WP_001213794.1.73948 WP_001213794.1.73999 WP_001213794.1.74024 WP_001213794.1.74030 WP_001213794.1.74038 WP_001213794.1.74043 WP_001213794.1.74058 WP_001213794.1.74070 WP_001213794.1.74077 WP_001213794.1.74135 WP_001213794.1.74214 WP_001213794.1.74241 WP_001213794.1.74285 WP_001213794.1.7430 WP_001213794.1.74317 WP_001213794.1.74415 WP_001213794.1.74616 WP_001213794.1.74621 WP_001213794.1.74639 WP_001213794.1.74647 WP_001213794.1.74677 WP_001213794.1.74699 WP_001213794.1.74831 WP_001213794.1.74894 WP_001213794.1.74929 WP_001213794.1.74939 WP_001213794.1.74973 WP_001213794.1.7507 WP_001213794.1.75089 WP_001213794.1.75116 WP_001213794.1.75180 WP_001213794.1.75237 WP_001213794.1.75273 WP_001213794.1.75296 WP_001213794.1.75413 WP_001213794.1.75433 WP_001213794.1.75532 WP_001213794.1.75565 WP_001213794.1.75593 WP_001213794.1.75610 WP_001213794.1.75633 WP_001213794.1.75718 WP_001213794.1.75745 WP_001213794.1.75844 WP_001213794.1.75886 WP_001213794.1.75898 WP_001213794.1.76081 WP_001213794.1.76116 WP_001213794.1.76122 WP_001213794.1.76256 WP_001213794.1.76339 WP_001213794.1.76366 WP_001213794.1.76417 WP_001213794.1.7646 WP_001213794.1.76510 WP_001213794.1.76558 WP_001213794.1.76572 WP_001213794.1.76641 WP_001213794.1.76651 WP_001213794.1.76653 WP_001213794.1.76788 WP_001213794.1.76854 WP_001213794.1.76916 WP_001213794.1.76932 WP_001213794.1.76973 WP_001213794.1.76988 WP_001213794.1.77016 WP_001213794.1.77087 WP_001213794.1.77090 WP_001213794.1.77111 WP_001213794.1.77299 WP_001213794.1.77384 WP_001213794.1.77436 WP_001213794.1.77501 WP_001213794.1.77512 WP_001213794.1.77513 WP_001213794.1.77563 WP_001213794.1.77702 WP_001213794.1.77713 WP_001213794.1.7772 WP_001213794.1.77754 WP_001213794.1.77825 WP_001213794.1.77837 WP_001213794.1.77900 WP_001213794.1.77923 WP_001213794.1.77975 WP_001213794.1.78035 WP_001213794.1.78048 WP_001213794.1.78107 WP_001213794.1.78166 WP_001213794.1.78192 WP_001213794.1.78195 WP_001213794.1.78291 WP_001213794.1.78309 WP_001213794.1.78320 WP_001213794.1.78382 WP_001213794.1.78388 WP_001213794.1.78410 WP_001213794.1.7862 WP_001213794.1.78626 WP_001213794.1.78661 WP_001213794.1.78674 WP_001213794.1.78676 WP_001213794.1.78761 WP_001213794.1.789 WP_001213794.1.78993 WP_001213794.1.79012 WP_001213794.1.79069 WP_001213794.1.79074 WP_001213794.1.79098 WP_001213794.1.79155 WP_001213794.1.79164 WP_001213794.1.79204 WP_001213794.1.79280 WP_001213794.1.79397 WP_001213794.1.79456 WP_001213794.1.79532 WP_001213794.1.79547 WP_001213794.1.79654 WP_001213794.1.7970 WP_001213794.1.79722 WP_001213794.1.79772 WP_001213794.1.79880 WP_001213794.1.79914 WP_001213794.1.79916 WP_001213794.1.80065 WP_001213794.1.80103 WP_001213794.1.80273 WP_001213794.1.80282 WP_001213794.1.80354 WP_001213794.1.80368 WP_001213794.1.80386 WP_001213794.1.80400 WP_001213794.1.80462 WP_001213794.1.80479 WP_001213794.1.8049 WP_001213794.1.80492 WP_001213794.1.80569 WP_001213794.1.80664 WP_001213794.1.80696 WP_001213794.1.80984 WP_001213794.1.81131 WP_001213794.1.81187 WP_001213794.1.81262 WP_001213794.1.81268 WP_001213794.1.81269 WP_001213794.1.81271 WP_001213794.1.8131 WP_001213794.1.81333 WP_001213794.1.81342 WP_001213794.1.81364 WP_001213794.1.81494 WP_001213794.1.81557 WP_001213794.1.81676 WP_001213794.1.81681 WP_001213794.1.8170 WP_001213794.1.81763 WP_001213794.1.81855 WP_001213794.1.81921 WP_001213794.1.81931 WP_001213794.1.81936 WP_001213794.1.81949 WP_001213794.1.82070 WP_001213794.1.82076 WP_001213794.1.82131 WP_001213794.1.82144 WP_001213794.1.82156 WP_001213794.1.8218 WP_001213794.1.82180 WP_001213794.1.82201 WP_001213794.1.82214 WP_001213794.1.82225 WP_001213794.1.8240 WP_001213794.1.82408 WP_001213794.1.82416 WP_001213794.1.8242 WP_001213794.1.82456 WP_001213794.1.82465 WP_001213794.1.82473 WP_001213794.1.82553 WP_001213794.1.82646 WP_001213794.1.82670 WP_001213794.1.82731 WP_001213794.1.82812 WP_001213794.1.82850 WP_001213794.1.82872 WP_001213794.1.8294 WP_001213794.1.82959 WP_001213794.1.83007 WP_001213794.1.8304 WP_001213794.1.83180 WP_001213794.1.83229 WP_001213794.1.83235 WP_001213794.1.83290 WP_001213794.1.83333 WP_001213794.1.83516 WP_001213794.1.83657 WP_001213794.1.83677 WP_001213794.1.8375 WP_001213794.1.83923 WP_001213794.1.83994 WP_001213794.1.84 WP_001213794.1.8406 WP_001213794.1.84076 WP_001213794.1.84110 WP_001213794.1.84127 WP_001213794.1.84150 WP_001213794.1.84230 WP_001213794.1.84252 WP_001213794.1.8431 WP_001213794.1.84345 WP_001213794.1.84369 WP_001213794.1.84401 WP_001213794.1.84435 WP_001213794.1.84475 WP_001213794.1.84567 WP_001213794.1.84631 WP_001213794.1.84727 WP_001213794.1.84744 WP_001213794.1.84773 WP_001213794.1.84945 WP_001213794.1.84967 WP_001213794.1.85004 WP_001213794.1.8502 WP_001213794.1.85039 WP_001213794.1.85153 WP_001213794.1.85273 WP_001213794.1.85338 WP_001213794.1.85339 WP_001213794.1.85511 WP_001213794.1.85512 WP_001213794.1.8557 WP_001213794.1.85606 WP_001213794.1.85635 WP_001213794.1.85646 WP_001213794.1.85654 WP_001213794.1.85665 WP_001213794.1.85669 WP_001213794.1.85688 WP_001213794.1.85703 WP_001213794.1.85728 WP_001213794.1.85742 WP_001213794.1.85746 WP_001213794.1.85811 WP_001213794.1.859 WP_001213794.1.85917 WP_001213794.1.8594 WP_001213794.1.85977 WP_001213794.1.860 WP_001213794.1.8605 WP_001213794.1.86084 WP_001213794.1.8610 WP_001213794.1.86126 WP_001213794.1.8614 WP_001213794.1.86156 WP_001213794.1.86323 WP_001213794.1.86342 WP_001213794.1.86389 WP_001213794.1.8640 WP_001213794.1.8642 WP_001213794.1.86426 WP_001213794.1.86489 WP_001213794.1.86530 WP_001213794.1.86663 WP_001213794.1.86770 WP_001213794.1.86794 WP_001213794.1.86800 WP_001213794.1.86807 WP_001213794.1.86811 WP_001213794.1.86815 WP_001213794.1.86860 WP_001213794.1.86945 WP_001213794.1.86989 WP_001213794.1.87023 WP_001213794.1.87034 WP_001213794.1.87041 WP_001213794.1.87136 WP_001213794.1.87155 WP_001213794.1.87258 WP_001213794.1.87293 WP_001213794.1.87420 WP_001213794.1.87528 WP_001213794.1.87560 WP_001213794.1.8760 WP_001213794.1.87600 WP_001213794.1.87609 WP_001213794.1.87612 WP_001213794.1.87615 WP_001213794.1.87653 WP_001213794.1.87659 WP_001213794.1.87698 WP_001213794.1.87706 WP_001213794.1.87739 WP_001213794.1.87741 WP_001213794.1.87742 WP_001213794.1.87852 WP_001213794.1.87949 WP_001213794.1.88025 WP_001213794.1.88026 WP_001213794.1.8805 WP_001213794.1.8806 WP_001213794.1.881 WP_001213794.1.88145 WP_001213794.1.88199 WP_001213794.1.88299 WP_001213794.1.88313 WP_001213794.1.88359 WP_001213794.1.88407 WP_001213794.1.88414 WP_001213794.1.88444 WP_001213794.1.88446 WP_001213794.1.88458 WP_001213794.1.88501 WP_001213794.1.88538 WP_001213794.1.88547 WP_001213794.1.886 WP_001213794.1.88647 WP_001213794.1.88648 WP_001213794.1.88692 WP_001213794.1.88698 WP_001213794.1.88707 WP_001213794.1.88727 WP_001213794.1.88772 WP_001213794.1.88850 WP_001213794.1.8889 WP_001213794.1.88892 WP_001213794.1.88894 WP_001213794.1.89182 WP_001213794.1.89298 WP_001213794.1.89308 WP_001213794.1.89314 WP_001213794.1.89328 WP_001213794.1.89332 WP_001213794.1.89343 WP_001213794.1.89395 WP_001213794.1.8940 WP_001213794.1.89449 WP_001213794.1.8947 WP_001213794.1.89503 WP_001213794.1.89591 WP_001213794.1.89612 WP_001213794.1.89632 WP_001213794.1.89668 WP_001213794.1.89706 WP_001213794.1.89713 WP_001213794.1.89733 WP_001213794.1.89796 WP_001213794.1.89804 WP_001213794.1.89845 WP_001213794.1.89888 WP_001213794.1.89911 WP_001213794.1.8995 WP_001213794.1.89952 WP_001213794.1.90007 WP_001213794.1.9011 WP_001213794.1.90196 WP_001213794.1.90240 WP_001213794.1.90274 WP_001213794.1.90280 WP_001213794.1.90330 WP_001213794.1.90338 WP_001213794.1.90365 WP_001213794.1.90428 WP_001213794.1.90489 WP_001213794.1.90513 WP_001213794.1.90582 WP_001213794.1.90713 WP_001213794.1.90794 WP_001213794.1.90796 WP_001213794.1.90811 WP_001213794.1.9091 WP_001213794.1.91067 WP_001213794.1.91164 WP_001213794.1.91205 WP_001213794.1.91239 WP_001213794.1.91291 WP_001213794.1.91313 WP_001213794.1.9135 WP_001213794.1.91506 WP_001213794.1.91557 WP_001213794.1.91597 WP_001213794.1.91715 WP_001213794.1.9187 WP_001213794.1.91870 WP_001213794.1.91914 WP_001213794.1.92018 WP_001213794.1.92087 WP_001213794.1.92098 WP_001213794.1.92156 WP_001213794.1.92172 WP_001213794.1.92240 WP_001213794.1.92243 WP_001213794.1.92327 WP_001213794.1.92470 WP_001213794.1.92477 WP_001213794.1.9253 WP_001213794.1.92545 WP_001213794.1.92570 WP_001213794.1.92588 WP_001213794.1.926 WP_001213794.1.92633 WP_001213794.1.92649 WP_001213794.1.92676 WP_001213794.1.92705 WP_001213794.1.9271 WP_001213794.1.92734 WP_001213794.1.92810 WP_001213794.1.92823 WP_001213794.1.92987 WP_001213794.1.93007 WP_001213794.1.93022 WP_001213794.1.93103 WP_001213794.1.93105 WP_001213794.1.93111 WP_001213794.1.93121 WP_001213794.1.93168 WP_001213794.1.93184 WP_001213794.1.93221 WP_001213794.1.93223 WP_001213794.1.93239 WP_001213794.1.93302 WP_001213794.1.9336 WP_001213794.1.93387 WP_001213794.1.93469 WP_001213794.1.93511 WP_001213794.1.93512 WP_001213794.1.93635 WP_001213794.1.93657 WP_001213794.1.93691 WP_001213794.1.9374 WP_001213794.1.9375 WP_001213794.1.93754 WP_001213794.1.93780 WP_001213794.1.93828 WP_001213794.1.93842 WP_001213794.1.93843 WP_001213794.1.93875 WP_001213794.1.93909 WP_001213794.1.93919 WP_001213794.1.93938 WP_001213794.1.93984 WP_001213794.1.9399 WP_001213794.1.94017 WP_001213794.1.94039 WP_001213794.1.94079 WP_001213794.1.94097 WP_001213794.1.94107 WP_001213794.1.94142 WP_001213794.1.94215 WP_001213794.1.94303 WP_001213794.1.94365 WP_001213794.1.94390 WP_001213794.1.94415 WP_001213794.1.94492 WP_001213794.1.94510 WP_001213794.1.94527 WP_001213794.1.94573 WP_001213794.1.94579 WP_001213794.1.94586 WP_001213794.1.94588 WP_001213794.1.94593 WP_001213794.1.94650 WP_001213794.1.94659 WP_001213794.1.94662 WP_001213794.1.94700 WP_001213794.1.94745 WP_001213794.1.94782 WP_001213794.1.94815 WP_001213794.1.94820 WP_001213794.1.94850 WP_001213794.1.94851 WP_001213794.1.94864 WP_001213794.1.94952 WP_001213794.1.94982 WP_001213794.1.95006 WP_001213794.1.95055 WP_001213794.1.95076 WP_001213794.1.95099 WP_001213794.1.95165 WP_001213794.1.95239 WP_001213794.1.95246 WP_001213794.1.9525 WP_001213794.1.95255 WP_001213794.1.95265 WP_001213794.1.95338 WP_001213794.1.95412 WP_001213794.1.95530 WP_001213794.1.95547 WP_001213794.1.95579 WP_001213794.1.95590 WP_001213794.1.95625 WP_001213794.1.95675 WP_001213794.1.95716 WP_001213794.1.95776 WP_001213794.1.95803 WP_001213794.1.95884 WP_001213794.1.95890 WP_001213794.1.95906 WP_001213794.1.96025 WP_001213794.1.96044 WP_001213794.1.96054 WP_001213794.1.96094 WP_001213794.1.96127 WP_001213794.1.96144 WP_001213794.1.96188 WP_001213794.1.96211 WP_001213794.1.96212 WP_001213794.1.96319 WP_001213794.1.9633 WP_001213794.1.96359 WP_001213794.1.96539 WP_001213794.1.96552 WP_001213794.1.96610 WP_001213794.1.96625 WP_001213794.1.96635 WP_001213794.1.9664 WP_001213794.1.96675 WP_001213794.1.9670 WP_001213794.1.96750 WP_001213794.1.96792 WP_001213794.1.96801 WP_001213794.1.96803 WP_001213794.1.96925 WP_001213794.1.96938 WP_001213794.1.96946 WP_001213794.1.96957 WP_001213794.1.96978 WP_001213794.1.97026 WP_001213794.1.97028 WP_001213794.1.97079 WP_001213794.1.97154 WP_001213794.1.97184 WP_001213794.1.97287 WP_001213794.1.97291 WP_001213794.1.97422 WP_001213794.1.97441 WP_001213794.1.97480 WP_001213794.1.97497 WP_001213794.1.97505 WP_001213794.1.97599 WP_001213794.1.97606 WP_001213794.1.97615 WP_001213794.1.97646 WP_001213794.1.97690 WP_001213794.1.97819 WP_001213794.1.97840 WP_001213794.1.97938 WP_001213794.1.98036 WP_001213794.1.98080 WP_001213794.1.98086 WP_001213794.1.98158 WP_001213794.1.98263 WP_001213794.1.98418 WP_001213794.1.98448 WP_001213794.1.98457 WP_001213794.1.9850 WP_001213794.1.98502 WP_001213794.1.98607 WP_001213794.1.98627 WP_001213794.1.98731 WP_001213794.1.98762 WP_001213794.1.9877 WP_001213794.1.98801 WP_001213794.1.98818 WP_001213794.1.99163 WP_001213794.1.99198 WP_001213794.1.99335 WP_001213794.1.99350 WP_001213794.1.99360 WP_001213794.1.99363 WP_001213794.1.99369 WP_001213794.1.99388 WP_001213794.1.99397 WP_001213794.1.99463 WP_001213794.1.99483 WP_001213794.1.99546 WP_001213794.1.99579 WP_001213794.1.99595 WP_001213794.1.99671 WP_001213794.1.99676 WP_001213794.1.99764 WP_001213794.1.99829 WP_001213794.1.99837 WP_001213794.1.99841 WP_001213794.1.9992 WP_001213794.1.99996 gi|378961977|ref|YP_005219463.1| gi|29144090|ref|NP_807432.1| gi|549480992|ref|YP_008615345.1| AE014613|CDS_3929522-3930718 AL513382|CDS_3944023-3945219 209261.t3810 220341.STY4086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]