SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16762716|ref|NP_458333.1| from Salmonella enterica subsp. enterica serovar Typhi str. CT18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16762716|ref|NP_458333.1|
Domain Number 1 Region: 1-386
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.05e-75
Family Cystathionine synthase-like 0.0000375
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16762716|ref|NP_458333.1|
Sequence length 388
Comment aminotransferase [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
Sequence
MKYDFNEIYQRIASEKWEYDSVINGFPVIPMSVADTDLVSPVEVRQALIEVCNRREFGYP
AYHDDFKDVLASWYDRYYDWRPDTADIIETPPLLMTMGAFIRGMTQCNESVVVMTPVYHS
FARTIRENHRAVTECDLLRDENNHYTIDFEKLEDTCSRPENKILIFCNPHNPVGRCWTEE
EVRKVAAIAQKTGTILISDEIHADFVYDEKCYTPVMKAAENLNGIIVFLSGGKLFNIGGI
FSSYVFTADPVFKKQMAVVLKELHFQPTAFAHEAAYAGYKYYHDYREEVVNHIRKMQIKL
VNGLNNMPYPVKANLPEATYLVWADFNDTGWSGDRIQEFLVQDAGLGFNRGDQFGVAGTG
FARINCGVPESRIDEALSRLEKAFSKYF
Download sequence
Identical sequences Q8Z263
gi|16762716|ref|NP_458333.1| gi|488656370|ref|YP_007928173.1| NP_458333.1.84458 WP_000872632.1.100008 WP_000872632.1.100036 WP_000872632.1.100079 WP_000872632.1.100196 WP_000872632.1.100284 WP_000872632.1.100313 WP_000872632.1.100314 WP_000872632.1.100321 WP_000872632.1.100354 WP_000872632.1.100421 WP_000872632.1.100446 WP_000872632.1.100450 WP_000872632.1.100592 WP_000872632.1.100610 WP_000872632.1.100732 WP_000872632.1.100733 WP_000872632.1.100739 WP_000872632.1.100764 WP_000872632.1.100799 WP_000872632.1.100941 WP_000872632.1.100953 WP_000872632.1.101011 WP_000872632.1.10108 WP_000872632.1.101226 WP_000872632.1.10124 WP_000872632.1.101271 WP_000872632.1.101312 WP_000872632.1.101322 WP_000872632.1.101374 WP_000872632.1.101616 WP_000872632.1.101890 WP_000872632.1.101941 WP_000872632.1.102050 WP_000872632.1.102087 WP_000872632.1.10338 WP_000872632.1.1038 WP_000872632.1.104 WP_000872632.1.10401 WP_000872632.1.10428 WP_000872632.1.10459 WP_000872632.1.10475 WP_000872632.1.10511 WP_000872632.1.10514 WP_000872632.1.10530 WP_000872632.1.10532 WP_000872632.1.10547 WP_000872632.1.10595 WP_000872632.1.10642 WP_000872632.1.10654 WP_000872632.1.10677 WP_000872632.1.10857 WP_000872632.1.10873 WP_000872632.1.10926 WP_000872632.1.10936 WP_000872632.1.11012 WP_000872632.1.11055 WP_000872632.1.11126 WP_000872632.1.11142 WP_000872632.1.11239 WP_000872632.1.11253 WP_000872632.1.11314 WP_000872632.1.11385 WP_000872632.1.1142 WP_000872632.1.11426 WP_000872632.1.11429 WP_000872632.1.11557 WP_000872632.1.11567 WP_000872632.1.11638 WP_000872632.1.11883 WP_000872632.1.11908 WP_000872632.1.11914 WP_000872632.1.12040 WP_000872632.1.12061 WP_000872632.1.1207 WP_000872632.1.12141 WP_000872632.1.12172 WP_000872632.1.12192 WP_000872632.1.12364 WP_000872632.1.12398 WP_000872632.1.12441 WP_000872632.1.12581 WP_000872632.1.12620 WP_000872632.1.12648 WP_000872632.1.12683 WP_000872632.1.12726 WP_000872632.1.12727 WP_000872632.1.12741 WP_000872632.1.12834 WP_000872632.1.13108 WP_000872632.1.13161 WP_000872632.1.1321 WP_000872632.1.13268 WP_000872632.1.13291 WP_000872632.1.133 WP_000872632.1.13314 WP_000872632.1.13338 WP_000872632.1.13342 WP_000872632.1.13352 WP_000872632.1.13406 WP_000872632.1.13440 WP_000872632.1.13443 WP_000872632.1.13476 WP_000872632.1.13599 WP_000872632.1.13686 WP_000872632.1.1372 WP_000872632.1.13732 WP_000872632.1.1382 WP_000872632.1.1397 WP_000872632.1.13972 WP_000872632.1.140 WP_000872632.1.1408 WP_000872632.1.14089 WP_000872632.1.14099 WP_000872632.1.14120 WP_000872632.1.14150 WP_000872632.1.14191 WP_000872632.1.14197 WP_000872632.1.14280 WP_000872632.1.14333 WP_000872632.1.14399 WP_000872632.1.14444 WP_000872632.1.14467 WP_000872632.1.14474 WP_000872632.1.14500 WP_000872632.1.14526 WP_000872632.1.14550 WP_000872632.1.14575 WP_000872632.1.14701 WP_000872632.1.14703 WP_000872632.1.14719 WP_000872632.1.1473 WP_000872632.1.14765 WP_000872632.1.14810 WP_000872632.1.14877 WP_000872632.1.14894 WP_000872632.1.14930 WP_000872632.1.14947 WP_000872632.1.14948 WP_000872632.1.15184 WP_000872632.1.15244 WP_000872632.1.15265 WP_000872632.1.15362 WP_000872632.1.15415 WP_000872632.1.15423 WP_000872632.1.15439 WP_000872632.1.15487 WP_000872632.1.15535 WP_000872632.1.15581 WP_000872632.1.15597 WP_000872632.1.15710 WP_000872632.1.15717 WP_000872632.1.15905 WP_000872632.1.15912 WP_000872632.1.15970 WP_000872632.1.16046 WP_000872632.1.16051 WP_000872632.1.16058 WP_000872632.1.16150 WP_000872632.1.16155 WP_000872632.1.1626 WP_000872632.1.16264 WP_000872632.1.16344 WP_000872632.1.16452 WP_000872632.1.16461 WP_000872632.1.16462 WP_000872632.1.16465 WP_000872632.1.16522 WP_000872632.1.16588 WP_000872632.1.16658 WP_000872632.1.16666 WP_000872632.1.16673 WP_000872632.1.1674 WP_000872632.1.16767 WP_000872632.1.16781 WP_000872632.1.16879 WP_000872632.1.16893 WP_000872632.1.16905 WP_000872632.1.16948 WP_000872632.1.17049 WP_000872632.1.17058 WP_000872632.1.17078 WP_000872632.1.17202 WP_000872632.1.17219 WP_000872632.1.1722 WP_000872632.1.17302 WP_000872632.1.17308 WP_000872632.1.17368 WP_000872632.1.17405 WP_000872632.1.17406 WP_000872632.1.17513 WP_000872632.1.17543 WP_000872632.1.17563 WP_000872632.1.17578 WP_000872632.1.17622 WP_000872632.1.17659 WP_000872632.1.17667 WP_000872632.1.17686 WP_000872632.1.17741 WP_000872632.1.17956 WP_000872632.1.18005 WP_000872632.1.1801 WP_000872632.1.18021 WP_000872632.1.18099 WP_000872632.1.18124 WP_000872632.1.18144 WP_000872632.1.18173 WP_000872632.1.18270 WP_000872632.1.18280 WP_000872632.1.18328 WP_000872632.1.18358 WP_000872632.1.18370 WP_000872632.1.18406 WP_000872632.1.18474 WP_000872632.1.18513 WP_000872632.1.18610 WP_000872632.1.18678 WP_000872632.1.18722 WP_000872632.1.18766 WP_000872632.1.1880 WP_000872632.1.1885 WP_000872632.1.18860 WP_000872632.1.18922 WP_000872632.1.18959 WP_000872632.1.19001 WP_000872632.1.19006 WP_000872632.1.19044 WP_000872632.1.19084 WP_000872632.1.19187 WP_000872632.1.19228 WP_000872632.1.19288 WP_000872632.1.19300 WP_000872632.1.19422 WP_000872632.1.19454 WP_000872632.1.19456 WP_000872632.1.19496 WP_000872632.1.19535 WP_000872632.1.19538 WP_000872632.1.19589 WP_000872632.1.19663 WP_000872632.1.19686 WP_000872632.1.19731 WP_000872632.1.19794 WP_000872632.1.1992 WP_000872632.1.19999 WP_000872632.1.20254 WP_000872632.1.20255 WP_000872632.1.20296 WP_000872632.1.20339 WP_000872632.1.20419 WP_000872632.1.20465 WP_000872632.1.20492 WP_000872632.1.2053 WP_000872632.1.20635 WP_000872632.1.20718 WP_000872632.1.2073 WP_000872632.1.20740 WP_000872632.1.20828 WP_000872632.1.2087 WP_000872632.1.20883 WP_000872632.1.20947 WP_000872632.1.20953 WP_000872632.1.2106 WP_000872632.1.21062 WP_000872632.1.21144 WP_000872632.1.21162 WP_000872632.1.21184 WP_000872632.1.21185 WP_000872632.1.21366 WP_000872632.1.21492 WP_000872632.1.2166 WP_000872632.1.21674 WP_000872632.1.21946 WP_000872632.1.21966 WP_000872632.1.22064 WP_000872632.1.22118 WP_000872632.1.22126 WP_000872632.1.22208 WP_000872632.1.2227 WP_000872632.1.22373 WP_000872632.1.22476 WP_000872632.1.22614 WP_000872632.1.22652 WP_000872632.1.22683 WP_000872632.1.2284 WP_000872632.1.22895 WP_000872632.1.22926 WP_000872632.1.22943 WP_000872632.1.22967 WP_000872632.1.23040 WP_000872632.1.23058 WP_000872632.1.23218 WP_000872632.1.2331 WP_000872632.1.2332 WP_000872632.1.23340 WP_000872632.1.2336 WP_000872632.1.23365 WP_000872632.1.23412 WP_000872632.1.23426 WP_000872632.1.23492 WP_000872632.1.23515 WP_000872632.1.23548 WP_000872632.1.23571 WP_000872632.1.23604 WP_000872632.1.23679 WP_000872632.1.23728 WP_000872632.1.2375 WP_000872632.1.23783 WP_000872632.1.23786 WP_000872632.1.23787 WP_000872632.1.23801 WP_000872632.1.24028 WP_000872632.1.24061 WP_000872632.1.24083 WP_000872632.1.24117 WP_000872632.1.24125 WP_000872632.1.24138 WP_000872632.1.24153 WP_000872632.1.24291 WP_000872632.1.24322 WP_000872632.1.24355 WP_000872632.1.24400 WP_000872632.1.24420 WP_000872632.1.24619 WP_000872632.1.24688 WP_000872632.1.24716 WP_000872632.1.2481 WP_000872632.1.24832 WP_000872632.1.24964 WP_000872632.1.25017 WP_000872632.1.25032 WP_000872632.1.25041 WP_000872632.1.25053 WP_000872632.1.25140 WP_000872632.1.25185 WP_000872632.1.25196 WP_000872632.1.25210 WP_000872632.1.25219 WP_000872632.1.25304 WP_000872632.1.25374 WP_000872632.1.25475 WP_000872632.1.25490 WP_000872632.1.25508 WP_000872632.1.25603 WP_000872632.1.2562 WP_000872632.1.25666 WP_000872632.1.25821 WP_000872632.1.25833 WP_000872632.1.25835 WP_000872632.1.25882 WP_000872632.1.25911 WP_000872632.1.25962 WP_000872632.1.25963 WP_000872632.1.26001 WP_000872632.1.26027 WP_000872632.1.26107 WP_000872632.1.2615 WP_000872632.1.26217 WP_000872632.1.26230 WP_000872632.1.26232 WP_000872632.1.26272 WP_000872632.1.26286 WP_000872632.1.26288 WP_000872632.1.26394 WP_000872632.1.26491 WP_000872632.1.2654 WP_000872632.1.26554 WP_000872632.1.26636 WP_000872632.1.26689 WP_000872632.1.2679 WP_000872632.1.26908 WP_000872632.1.2692 WP_000872632.1.26928 WP_000872632.1.270 WP_000872632.1.27008 WP_000872632.1.27027 WP_000872632.1.27070 WP_000872632.1.27077 WP_000872632.1.27086 WP_000872632.1.27087 WP_000872632.1.27111 WP_000872632.1.27115 WP_000872632.1.2713 WP_000872632.1.2717 WP_000872632.1.27228 WP_000872632.1.27282 WP_000872632.1.27285 WP_000872632.1.27309 WP_000872632.1.27329 WP_000872632.1.27361 WP_000872632.1.27565 WP_000872632.1.27595 WP_000872632.1.27598 WP_000872632.1.27706 WP_000872632.1.27775 WP_000872632.1.27785 WP_000872632.1.27900 WP_000872632.1.27928 WP_000872632.1.27945 WP_000872632.1.28004 WP_000872632.1.2809 WP_000872632.1.28155 WP_000872632.1.2822 WP_000872632.1.28229 WP_000872632.1.28384 WP_000872632.1.28386 WP_000872632.1.28395 WP_000872632.1.284 WP_000872632.1.2845 WP_000872632.1.28479 WP_000872632.1.28627 WP_000872632.1.28692 WP_000872632.1.2873 WP_000872632.1.28917 WP_000872632.1.28962 WP_000872632.1.29023 WP_000872632.1.29042 WP_000872632.1.2905 WP_000872632.1.2907 WP_000872632.1.29081 WP_000872632.1.29089 WP_000872632.1.29153 WP_000872632.1.29203 WP_000872632.1.29237 WP_000872632.1.29248 WP_000872632.1.29288 WP_000872632.1.29389 WP_000872632.1.29439 WP_000872632.1.2946 WP_000872632.1.29462 WP_000872632.1.29563 WP_000872632.1.29727 WP_000872632.1.29743 WP_000872632.1.29782 WP_000872632.1.29833 WP_000872632.1.29851 WP_000872632.1.29865 WP_000872632.1.29886 WP_000872632.1.29919 WP_000872632.1.2994 WP_000872632.1.29964 WP_000872632.1.29983 WP_000872632.1.30009 WP_000872632.1.30013 WP_000872632.1.3002 WP_000872632.1.30034 WP_000872632.1.30049 WP_000872632.1.30058 WP_000872632.1.30172 WP_000872632.1.30185 WP_000872632.1.30354 WP_000872632.1.30357 WP_000872632.1.30362 WP_000872632.1.3042 WP_000872632.1.30421 WP_000872632.1.30440 WP_000872632.1.30448 WP_000872632.1.30489 WP_000872632.1.30517 WP_000872632.1.30542 WP_000872632.1.30544 WP_000872632.1.30556 WP_000872632.1.30572 WP_000872632.1.30585 WP_000872632.1.30618 WP_000872632.1.30664 WP_000872632.1.30688 WP_000872632.1.30806 WP_000872632.1.30967 WP_000872632.1.31046 WP_000872632.1.31066 WP_000872632.1.31078 WP_000872632.1.31139 WP_000872632.1.31145 WP_000872632.1.31182 WP_000872632.1.31205 WP_000872632.1.3121 WP_000872632.1.31303 WP_000872632.1.3131 WP_000872632.1.31352 WP_000872632.1.31389 WP_000872632.1.31413 WP_000872632.1.31446 WP_000872632.1.31533 WP_000872632.1.31799 WP_000872632.1.31836 WP_000872632.1.31951 WP_000872632.1.32041 WP_000872632.1.32042 WP_000872632.1.3207 WP_000872632.1.32189 WP_000872632.1.32202 WP_000872632.1.32263 WP_000872632.1.32293 WP_000872632.1.32299 WP_000872632.1.32422 WP_000872632.1.32425 WP_000872632.1.32458 WP_000872632.1.32460 WP_000872632.1.32529 WP_000872632.1.32563 WP_000872632.1.32578 WP_000872632.1.32617 WP_000872632.1.3270 WP_000872632.1.32725 WP_000872632.1.32838 WP_000872632.1.32848 WP_000872632.1.3290 WP_000872632.1.32940 WP_000872632.1.32941 WP_000872632.1.3296 WP_000872632.1.32966 WP_000872632.1.32985 WP_000872632.1.33037 WP_000872632.1.3305 WP_000872632.1.33051 WP_000872632.1.33065 WP_000872632.1.33122 WP_000872632.1.3315 WP_000872632.1.33208 WP_000872632.1.33214 WP_000872632.1.33247 WP_000872632.1.33280 WP_000872632.1.33283 WP_000872632.1.33313 WP_000872632.1.33339 WP_000872632.1.33382 WP_000872632.1.33490 WP_000872632.1.33501 WP_000872632.1.33529 WP_000872632.1.33689 WP_000872632.1.3370 WP_000872632.1.33730 WP_000872632.1.33741 WP_000872632.1.33840 WP_000872632.1.3392 WP_000872632.1.33926 WP_000872632.1.33957 WP_000872632.1.33969 WP_000872632.1.34001 WP_000872632.1.34059 WP_000872632.1.34118 WP_000872632.1.34211 WP_000872632.1.34214 WP_000872632.1.34234 WP_000872632.1.34284 WP_000872632.1.34376 WP_000872632.1.34382 WP_000872632.1.34484 WP_000872632.1.34517 WP_000872632.1.34530 WP_000872632.1.34665 WP_000872632.1.34694 WP_000872632.1.34751 WP_000872632.1.34808 WP_000872632.1.34824 WP_000872632.1.34834 WP_000872632.1.34932 WP_000872632.1.34962 WP_000872632.1.35001 WP_000872632.1.35040 WP_000872632.1.35074 WP_000872632.1.35175 WP_000872632.1.35240 WP_000872632.1.35532 WP_000872632.1.35560 WP_000872632.1.3557 WP_000872632.1.35628 WP_000872632.1.3570 WP_000872632.1.35712 WP_000872632.1.35713 WP_000872632.1.35736 WP_000872632.1.35791 WP_000872632.1.35795 WP_000872632.1.35870 WP_000872632.1.35916 WP_000872632.1.35938 WP_000872632.1.35966 WP_000872632.1.36000 WP_000872632.1.36034 WP_000872632.1.36036 WP_000872632.1.36069 WP_000872632.1.36291 WP_000872632.1.36298 WP_000872632.1.36323 WP_000872632.1.36343 WP_000872632.1.36460 WP_000872632.1.3649 WP_000872632.1.36495 WP_000872632.1.36526 WP_000872632.1.36567 WP_000872632.1.36579 WP_000872632.1.36617 WP_000872632.1.36618 WP_000872632.1.36643 WP_000872632.1.36663 WP_000872632.1.36701 WP_000872632.1.36725 WP_000872632.1.36779 WP_000872632.1.36798 WP_000872632.1.36802 WP_000872632.1.36821 WP_000872632.1.36853 WP_000872632.1.36950 WP_000872632.1.37014 WP_000872632.1.37176 WP_000872632.1.37199 WP_000872632.1.37200 WP_000872632.1.37258 WP_000872632.1.37303 WP_000872632.1.37513 WP_000872632.1.37584 WP_000872632.1.37590 WP_000872632.1.37593 WP_000872632.1.37600 WP_000872632.1.37613 WP_000872632.1.37659 WP_000872632.1.37662 WP_000872632.1.37675 WP_000872632.1.37691 WP_000872632.1.37761 WP_000872632.1.37775 WP_000872632.1.37777 WP_000872632.1.378 WP_000872632.1.379 WP_000872632.1.37911 WP_000872632.1.37941 WP_000872632.1.37985 WP_000872632.1.38061 WP_000872632.1.38064 WP_000872632.1.38108 WP_000872632.1.3816 WP_000872632.1.38207 WP_000872632.1.38261 WP_000872632.1.38266 WP_000872632.1.38310 WP_000872632.1.3834 WP_000872632.1.38351 WP_000872632.1.3838 WP_000872632.1.38381 WP_000872632.1.38440 WP_000872632.1.38486 WP_000872632.1.38515 WP_000872632.1.38595 WP_000872632.1.3860 WP_000872632.1.38642 WP_000872632.1.38734 WP_000872632.1.38877 WP_000872632.1.38983 WP_000872632.1.38996 WP_000872632.1.39056 WP_000872632.1.3907 WP_000872632.1.39105 WP_000872632.1.3914 WP_000872632.1.39147 WP_000872632.1.39161 WP_000872632.1.39210 WP_000872632.1.39235 WP_000872632.1.3931 WP_000872632.1.39435 WP_000872632.1.39502 WP_000872632.1.39530 WP_000872632.1.39620 WP_000872632.1.39624 WP_000872632.1.39659 WP_000872632.1.39667 WP_000872632.1.39775 WP_000872632.1.39879 WP_000872632.1.39890 WP_000872632.1.39941 WP_000872632.1.39945 WP_000872632.1.39947 WP_000872632.1.40095 WP_000872632.1.40097 WP_000872632.1.401 WP_000872632.1.40160 WP_000872632.1.40167 WP_000872632.1.40279 WP_000872632.1.40361 WP_000872632.1.4042 WP_000872632.1.40467 WP_000872632.1.40496 WP_000872632.1.40517 WP_000872632.1.40698 WP_000872632.1.40750 WP_000872632.1.40763 WP_000872632.1.40854 WP_000872632.1.4089 WP_000872632.1.40924 WP_000872632.1.40932 WP_000872632.1.40946 WP_000872632.1.41004 WP_000872632.1.41070 WP_000872632.1.41074 WP_000872632.1.41075 WP_000872632.1.41097 WP_000872632.1.41132 WP_000872632.1.41176 WP_000872632.1.41251 WP_000872632.1.41258 WP_000872632.1.41305 WP_000872632.1.41321 WP_000872632.1.41333 WP_000872632.1.41335 WP_000872632.1.4136 WP_000872632.1.41415 WP_000872632.1.41459 WP_000872632.1.41498 WP_000872632.1.41519 WP_000872632.1.41524 WP_000872632.1.41631 WP_000872632.1.41658 WP_000872632.1.41659 WP_000872632.1.41716 WP_000872632.1.41746 WP_000872632.1.41824 WP_000872632.1.41825 WP_000872632.1.41836 WP_000872632.1.41919 WP_000872632.1.41929 WP_000872632.1.4194 WP_000872632.1.42069 WP_000872632.1.42081 WP_000872632.1.42090 WP_000872632.1.42111 WP_000872632.1.42187 WP_000872632.1.42200 WP_000872632.1.42219 WP_000872632.1.42257 WP_000872632.1.42261 WP_000872632.1.42349 WP_000872632.1.42364 WP_000872632.1.42371 WP_000872632.1.42379 WP_000872632.1.42391 WP_000872632.1.42603 WP_000872632.1.42650 WP_000872632.1.42701 WP_000872632.1.42805 WP_000872632.1.42815 WP_000872632.1.42859 WP_000872632.1.4298 WP_000872632.1.43008 WP_000872632.1.43016 WP_000872632.1.43019 WP_000872632.1.43065 WP_000872632.1.43068 WP_000872632.1.43069 WP_000872632.1.43128 WP_000872632.1.43141 WP_000872632.1.43157 WP_000872632.1.43161 WP_000872632.1.43190 WP_000872632.1.43198 WP_000872632.1.4326 WP_000872632.1.43290 WP_000872632.1.43292 WP_000872632.1.43307 WP_000872632.1.43513 WP_000872632.1.43633 WP_000872632.1.43637 WP_000872632.1.43651 WP_000872632.1.43722 WP_000872632.1.43801 WP_000872632.1.43812 WP_000872632.1.43878 WP_000872632.1.43888 WP_000872632.1.43919 WP_000872632.1.43974 WP_000872632.1.44049 WP_000872632.1.44101 WP_000872632.1.44160 WP_000872632.1.44180 WP_000872632.1.44196 WP_000872632.1.44248 WP_000872632.1.44262 WP_000872632.1.44268 WP_000872632.1.4427 WP_000872632.1.44296 WP_000872632.1.44343 WP_000872632.1.44351 WP_000872632.1.44360 WP_000872632.1.44416 WP_000872632.1.44431 WP_000872632.1.44437 WP_000872632.1.44546 WP_000872632.1.4468 WP_000872632.1.44762 WP_000872632.1.44815 WP_000872632.1.44828 WP_000872632.1.44879 WP_000872632.1.44917 WP_000872632.1.4501 WP_000872632.1.45072 WP_000872632.1.45093 WP_000872632.1.45136 WP_000872632.1.45241 WP_000872632.1.45435 WP_000872632.1.45596 WP_000872632.1.45648 WP_000872632.1.45829 WP_000872632.1.45871 WP_000872632.1.46030 WP_000872632.1.46077 WP_000872632.1.46169 WP_000872632.1.46225 WP_000872632.1.46241 WP_000872632.1.46307 WP_000872632.1.46355 WP_000872632.1.464 WP_000872632.1.46454 WP_000872632.1.46461 WP_000872632.1.46504 WP_000872632.1.46505 WP_000872632.1.46551 WP_000872632.1.46559 WP_000872632.1.46701 WP_000872632.1.46781 WP_000872632.1.46816 WP_000872632.1.46842 WP_000872632.1.4690 WP_000872632.1.46920 WP_000872632.1.46945 WP_000872632.1.47036 WP_000872632.1.47037 WP_000872632.1.47059 WP_000872632.1.47085 WP_000872632.1.47123 WP_000872632.1.47215 WP_000872632.1.47245 WP_000872632.1.47523 WP_000872632.1.47531 WP_000872632.1.47532 WP_000872632.1.47605 WP_000872632.1.47630 WP_000872632.1.4774 WP_000872632.1.47756 WP_000872632.1.4781 WP_000872632.1.47886 WP_000872632.1.47898 WP_000872632.1.48019 WP_000872632.1.48100 WP_000872632.1.48114 WP_000872632.1.48190 WP_000872632.1.48292 WP_000872632.1.48324 WP_000872632.1.48426 WP_000872632.1.48430 WP_000872632.1.48436 WP_000872632.1.48586 WP_000872632.1.4859 WP_000872632.1.48591 WP_000872632.1.48610 WP_000872632.1.48663 WP_000872632.1.48690 WP_000872632.1.48734 WP_000872632.1.48778 WP_000872632.1.48849 WP_000872632.1.48955 WP_000872632.1.48963 WP_000872632.1.48973 WP_000872632.1.49004 WP_000872632.1.49106 WP_000872632.1.49117 WP_000872632.1.49121 WP_000872632.1.4914 WP_000872632.1.49140 WP_000872632.1.49153 WP_000872632.1.49166 WP_000872632.1.49355 WP_000872632.1.49429 WP_000872632.1.49434 WP_000872632.1.49450 WP_000872632.1.495 WP_000872632.1.49545 WP_000872632.1.49703 WP_000872632.1.49769 WP_000872632.1.49846 WP_000872632.1.4991 WP_000872632.1.49947 WP_000872632.1.49959 WP_000872632.1.49997 WP_000872632.1.50030 WP_000872632.1.50043 WP_000872632.1.50103 WP_000872632.1.50158 WP_000872632.1.50247 WP_000872632.1.50308 WP_000872632.1.50309 WP_000872632.1.50387 WP_000872632.1.50406 WP_000872632.1.50468 WP_000872632.1.5051 WP_000872632.1.50566 WP_000872632.1.50570 WP_000872632.1.50626 WP_000872632.1.50726 WP_000872632.1.50771 WP_000872632.1.50875 WP_000872632.1.50885 WP_000872632.1.509 WP_000872632.1.50929 WP_000872632.1.50970 WP_000872632.1.51040 WP_000872632.1.51048 WP_000872632.1.51100 WP_000872632.1.51134 WP_000872632.1.51227 WP_000872632.1.5127 WP_000872632.1.51305 WP_000872632.1.51315 WP_000872632.1.5136 WP_000872632.1.51474 WP_000872632.1.51519 WP_000872632.1.51598 WP_000872632.1.51644 WP_000872632.1.51724 WP_000872632.1.51734 WP_000872632.1.51838 WP_000872632.1.51863 WP_000872632.1.51935 WP_000872632.1.52057 WP_000872632.1.52114 WP_000872632.1.52129 WP_000872632.1.52191 WP_000872632.1.52202 WP_000872632.1.52209 WP_000872632.1.52339 WP_000872632.1.52469 WP_000872632.1.52571 WP_000872632.1.526 WP_000872632.1.52647 WP_000872632.1.52742 WP_000872632.1.52773 WP_000872632.1.52795 WP_000872632.1.52807 WP_000872632.1.52887 WP_000872632.1.53092 WP_000872632.1.53141 WP_000872632.1.53151 WP_000872632.1.53154 WP_000872632.1.53159 WP_000872632.1.53210 WP_000872632.1.53233 WP_000872632.1.53307 WP_000872632.1.53321 WP_000872632.1.53375 WP_000872632.1.53450 WP_000872632.1.5349 WP_000872632.1.53540 WP_000872632.1.53555 WP_000872632.1.53559 WP_000872632.1.5356 WP_000872632.1.53571 WP_000872632.1.5358 WP_000872632.1.53692 WP_000872632.1.53723 WP_000872632.1.5374 WP_000872632.1.53750 WP_000872632.1.53800 WP_000872632.1.53815 WP_000872632.1.53839 WP_000872632.1.53892 WP_000872632.1.53898 WP_000872632.1.53902 WP_000872632.1.53981 WP_000872632.1.53984 WP_000872632.1.54132 WP_000872632.1.54170 WP_000872632.1.54175 WP_000872632.1.54203 WP_000872632.1.54259 WP_000872632.1.5430 WP_000872632.1.54371 WP_000872632.1.54431 WP_000872632.1.54442 WP_000872632.1.54482 WP_000872632.1.54589 WP_000872632.1.54667 WP_000872632.1.54678 WP_000872632.1.54681 WP_000872632.1.54748 WP_000872632.1.5481 WP_000872632.1.54865 WP_000872632.1.54935 WP_000872632.1.54979 WP_000872632.1.55010 WP_000872632.1.55034 WP_000872632.1.55163 WP_000872632.1.55165 WP_000872632.1.55215 WP_000872632.1.55290 WP_000872632.1.55310 WP_000872632.1.55317 WP_000872632.1.55379 WP_000872632.1.5539 WP_000872632.1.55468 WP_000872632.1.55506 WP_000872632.1.55604 WP_000872632.1.55639 WP_000872632.1.55699 WP_000872632.1.55725 WP_000872632.1.55780 WP_000872632.1.55967 WP_000872632.1.56144 WP_000872632.1.56172 WP_000872632.1.5621 WP_000872632.1.56226 WP_000872632.1.56311 WP_000872632.1.56419 WP_000872632.1.56423 WP_000872632.1.56514 WP_000872632.1.56535 WP_000872632.1.56585 WP_000872632.1.56640 WP_000872632.1.56724 WP_000872632.1.56825 WP_000872632.1.56887 WP_000872632.1.56889 WP_000872632.1.56981 WP_000872632.1.57101 WP_000872632.1.57137 WP_000872632.1.57147 WP_000872632.1.57179 WP_000872632.1.57186 WP_000872632.1.57342 WP_000872632.1.57684 WP_000872632.1.57699 WP_000872632.1.57785 WP_000872632.1.57800 WP_000872632.1.57873 WP_000872632.1.57965 WP_000872632.1.57972 WP_000872632.1.58008 WP_000872632.1.58044 WP_000872632.1.58081 WP_000872632.1.5809 WP_000872632.1.58132 WP_000872632.1.58173 WP_000872632.1.58191 WP_000872632.1.58194 WP_000872632.1.58261 WP_000872632.1.58274 WP_000872632.1.58282 WP_000872632.1.58324 WP_000872632.1.58326 WP_000872632.1.5836 WP_000872632.1.58485 WP_000872632.1.58537 WP_000872632.1.58583 WP_000872632.1.58652 WP_000872632.1.58663 WP_000872632.1.58724 WP_000872632.1.5875 WP_000872632.1.58796 WP_000872632.1.58807 WP_000872632.1.58847 WP_000872632.1.58883 WP_000872632.1.58898 WP_000872632.1.58949 WP_000872632.1.58963 WP_000872632.1.58970 WP_000872632.1.58974 WP_000872632.1.59020 WP_000872632.1.59043 WP_000872632.1.59056 WP_000872632.1.59061 WP_000872632.1.59064 WP_000872632.1.59282 WP_000872632.1.59299 WP_000872632.1.59313 WP_000872632.1.5949 WP_000872632.1.59501 WP_000872632.1.59510 WP_000872632.1.5969 WP_000872632.1.59751 WP_000872632.1.59827 WP_000872632.1.59829 WP_000872632.1.59847 WP_000872632.1.59863 WP_000872632.1.59969 WP_000872632.1.59994 WP_000872632.1.60045 WP_000872632.1.60076 WP_000872632.1.60114 WP_000872632.1.60154 WP_000872632.1.60168 WP_000872632.1.60192 WP_000872632.1.60199 WP_000872632.1.60212 WP_000872632.1.60253 WP_000872632.1.60322 WP_000872632.1.60324 WP_000872632.1.60356 WP_000872632.1.6038 WP_000872632.1.60380 WP_000872632.1.6041 WP_000872632.1.60424 WP_000872632.1.60481 WP_000872632.1.605 WP_000872632.1.6058 WP_000872632.1.60584 WP_000872632.1.6060 WP_000872632.1.60676 WP_000872632.1.60708 WP_000872632.1.60783 WP_000872632.1.60792 WP_000872632.1.60807 WP_000872632.1.60882 WP_000872632.1.60889 WP_000872632.1.60950 WP_000872632.1.6104 WP_000872632.1.61044 WP_000872632.1.61076 WP_000872632.1.61123 WP_000872632.1.61147 WP_000872632.1.61168 WP_000872632.1.61210 WP_000872632.1.61357 WP_000872632.1.61511 WP_000872632.1.61539 WP_000872632.1.61542 WP_000872632.1.61553 WP_000872632.1.61649 WP_000872632.1.61652 WP_000872632.1.61697 WP_000872632.1.61809 WP_000872632.1.61877 WP_000872632.1.61920 WP_000872632.1.62124 WP_000872632.1.62199 WP_000872632.1.62223 WP_000872632.1.62302 WP_000872632.1.62323 WP_000872632.1.62333 WP_000872632.1.62338 WP_000872632.1.62380 WP_000872632.1.62411 WP_000872632.1.62436 WP_000872632.1.62475 WP_000872632.1.62536 WP_000872632.1.62640 WP_000872632.1.62686 WP_000872632.1.62751 WP_000872632.1.62825 WP_000872632.1.62913 WP_000872632.1.62932 WP_000872632.1.62960 WP_000872632.1.63016 WP_000872632.1.63025 WP_000872632.1.63069 WP_000872632.1.63087 WP_000872632.1.63169 WP_000872632.1.63297 WP_000872632.1.63448 WP_000872632.1.63514 WP_000872632.1.63583 WP_000872632.1.63592 WP_000872632.1.63663 WP_000872632.1.63736 WP_000872632.1.63816 WP_000872632.1.63876 WP_000872632.1.6389 WP_000872632.1.63901 WP_000872632.1.63955 WP_000872632.1.63963 WP_000872632.1.64032 WP_000872632.1.64087 WP_000872632.1.64293 WP_000872632.1.64332 WP_000872632.1.644 WP_000872632.1.64471 WP_000872632.1.64501 WP_000872632.1.64538 WP_000872632.1.64632 WP_000872632.1.64648 WP_000872632.1.64654 WP_000872632.1.64662 WP_000872632.1.64663 WP_000872632.1.64709 WP_000872632.1.64710 WP_000872632.1.64744 WP_000872632.1.64763 WP_000872632.1.64817 WP_000872632.1.64847 WP_000872632.1.6487 WP_000872632.1.64891 WP_000872632.1.64974 WP_000872632.1.65075 WP_000872632.1.65172 WP_000872632.1.65191 WP_000872632.1.65200 WP_000872632.1.65211 WP_000872632.1.65218 WP_000872632.1.65226 WP_000872632.1.65249 WP_000872632.1.65266 WP_000872632.1.65395 WP_000872632.1.65459 WP_000872632.1.65463 WP_000872632.1.65487 WP_000872632.1.6549 WP_000872632.1.65499 WP_000872632.1.6554 WP_000872632.1.65650 WP_000872632.1.65697 WP_000872632.1.65699 WP_000872632.1.65737 WP_000872632.1.65755 WP_000872632.1.65812 WP_000872632.1.65846 WP_000872632.1.65863 WP_000872632.1.65985 WP_000872632.1.66021 WP_000872632.1.66031 WP_000872632.1.66052 WP_000872632.1.66064 WP_000872632.1.66109 WP_000872632.1.66145 WP_000872632.1.66183 WP_000872632.1.6620 WP_000872632.1.66216 WP_000872632.1.66234 WP_000872632.1.66273 WP_000872632.1.66324 WP_000872632.1.6634 WP_000872632.1.66361 WP_000872632.1.66480 WP_000872632.1.66506 WP_000872632.1.66665 WP_000872632.1.66681 WP_000872632.1.66684 WP_000872632.1.66755 WP_000872632.1.66759 WP_000872632.1.66801 WP_000872632.1.66860 WP_000872632.1.66953 WP_000872632.1.66955 WP_000872632.1.66981 WP_000872632.1.67024 WP_000872632.1.67042 WP_000872632.1.67101 WP_000872632.1.67143 WP_000872632.1.67201 WP_000872632.1.67211 WP_000872632.1.67237 WP_000872632.1.67336 WP_000872632.1.67339 WP_000872632.1.67387 WP_000872632.1.67394 WP_000872632.1.67397 WP_000872632.1.67403 WP_000872632.1.67430 WP_000872632.1.67442 WP_000872632.1.67539 WP_000872632.1.67556 WP_000872632.1.67576 WP_000872632.1.67604 WP_000872632.1.67619 WP_000872632.1.67625 WP_000872632.1.67627 WP_000872632.1.67641 WP_000872632.1.67657 WP_000872632.1.67673 WP_000872632.1.67700 WP_000872632.1.67718 WP_000872632.1.67729 WP_000872632.1.67774 WP_000872632.1.67820 WP_000872632.1.67910 WP_000872632.1.67954 WP_000872632.1.68 WP_000872632.1.68043 WP_000872632.1.68105 WP_000872632.1.68113 WP_000872632.1.68131 WP_000872632.1.68182 WP_000872632.1.6819 WP_000872632.1.68285 WP_000872632.1.68359 WP_000872632.1.68420 WP_000872632.1.68514 WP_000872632.1.68564 WP_000872632.1.68688 WP_000872632.1.68742 WP_000872632.1.68770 WP_000872632.1.68809 WP_000872632.1.68914 WP_000872632.1.69053 WP_000872632.1.69170 WP_000872632.1.69210 WP_000872632.1.69270 WP_000872632.1.69282 WP_000872632.1.69376 WP_000872632.1.69396 WP_000872632.1.69466 WP_000872632.1.69611 WP_000872632.1.69642 WP_000872632.1.69656 WP_000872632.1.69657 WP_000872632.1.69690 WP_000872632.1.69923 WP_000872632.1.69948 WP_000872632.1.69953 WP_000872632.1.70010 WP_000872632.1.70049 WP_000872632.1.70058 WP_000872632.1.70061 WP_000872632.1.70205 WP_000872632.1.70240 WP_000872632.1.70249 WP_000872632.1.70261 WP_000872632.1.70314 WP_000872632.1.7033 WP_000872632.1.70427 WP_000872632.1.70433 WP_000872632.1.70545 WP_000872632.1.70623 WP_000872632.1.70671 WP_000872632.1.70679 WP_000872632.1.70708 WP_000872632.1.70731 WP_000872632.1.70772 WP_000872632.1.70845 WP_000872632.1.70846 WP_000872632.1.70981 WP_000872632.1.70995 WP_000872632.1.71039 WP_000872632.1.71057 WP_000872632.1.71081 WP_000872632.1.71117 WP_000872632.1.71186 WP_000872632.1.71455 WP_000872632.1.71456 WP_000872632.1.71487 WP_000872632.1.71523 WP_000872632.1.71542 WP_000872632.1.71566 WP_000872632.1.71640 WP_000872632.1.71651 WP_000872632.1.71872 WP_000872632.1.71950 WP_000872632.1.71954 WP_000872632.1.71985 WP_000872632.1.72003 WP_000872632.1.72073 WP_000872632.1.72269 WP_000872632.1.72350 WP_000872632.1.72383 WP_000872632.1.72461 WP_000872632.1.72527 WP_000872632.1.7255 WP_000872632.1.72631 WP_000872632.1.72638 WP_000872632.1.72667 WP_000872632.1.72674 WP_000872632.1.72724 WP_000872632.1.72789 WP_000872632.1.72828 WP_000872632.1.72896 WP_000872632.1.72969 WP_000872632.1.72987 WP_000872632.1.73052 WP_000872632.1.7311 WP_000872632.1.73114 WP_000872632.1.73177 WP_000872632.1.73180 WP_000872632.1.73258 WP_000872632.1.73285 WP_000872632.1.7332 WP_000872632.1.7333 WP_000872632.1.73352 WP_000872632.1.73389 WP_000872632.1.73425 WP_000872632.1.73488 WP_000872632.1.73504 WP_000872632.1.7353 WP_000872632.1.73544 WP_000872632.1.73598 WP_000872632.1.7361 WP_000872632.1.73648 WP_000872632.1.73768 WP_000872632.1.73849 WP_000872632.1.73948 WP_000872632.1.73999 WP_000872632.1.74024 WP_000872632.1.74030 WP_000872632.1.74038 WP_000872632.1.74043 WP_000872632.1.74058 WP_000872632.1.74070 WP_000872632.1.74077 WP_000872632.1.74135 WP_000872632.1.74214 WP_000872632.1.74241 WP_000872632.1.74285 WP_000872632.1.7430 WP_000872632.1.74317 WP_000872632.1.74415 WP_000872632.1.74616 WP_000872632.1.74621 WP_000872632.1.74647 WP_000872632.1.74677 WP_000872632.1.74699 WP_000872632.1.74831 WP_000872632.1.74894 WP_000872632.1.74929 WP_000872632.1.74939 WP_000872632.1.74973 WP_000872632.1.7507 WP_000872632.1.75089 WP_000872632.1.75116 WP_000872632.1.75237 WP_000872632.1.75273 WP_000872632.1.75296 WP_000872632.1.75413 WP_000872632.1.75433 WP_000872632.1.75532 WP_000872632.1.75565 WP_000872632.1.75593 WP_000872632.1.75610 WP_000872632.1.75633 WP_000872632.1.75718 WP_000872632.1.75745 WP_000872632.1.75844 WP_000872632.1.75886 WP_000872632.1.75898 WP_000872632.1.76081 WP_000872632.1.76116 WP_000872632.1.76122 WP_000872632.1.76256 WP_000872632.1.76339 WP_000872632.1.76366 WP_000872632.1.76417 WP_000872632.1.7646 WP_000872632.1.76510 WP_000872632.1.76558 WP_000872632.1.76572 WP_000872632.1.76641 WP_000872632.1.76651 WP_000872632.1.76653 WP_000872632.1.76788 WP_000872632.1.76854 WP_000872632.1.76916 WP_000872632.1.76932 WP_000872632.1.76973 WP_000872632.1.76988 WP_000872632.1.77016 WP_000872632.1.77087 WP_000872632.1.77090 WP_000872632.1.77111 WP_000872632.1.77299 WP_000872632.1.77384 WP_000872632.1.77501 WP_000872632.1.77512 WP_000872632.1.77513 WP_000872632.1.77563 WP_000872632.1.77702 WP_000872632.1.77713 WP_000872632.1.7772 WP_000872632.1.77825 WP_000872632.1.77837 WP_000872632.1.77923 WP_000872632.1.77975 WP_000872632.1.78035 WP_000872632.1.78048 WP_000872632.1.78166 WP_000872632.1.78192 WP_000872632.1.78195 WP_000872632.1.78291 WP_000872632.1.78309 WP_000872632.1.78320 WP_000872632.1.78382 WP_000872632.1.78388 WP_000872632.1.78410 WP_000872632.1.7862 WP_000872632.1.78626 WP_000872632.1.78661 WP_000872632.1.78674 WP_000872632.1.78676 WP_000872632.1.78761 WP_000872632.1.789 WP_000872632.1.78993 WP_000872632.1.79012 WP_000872632.1.79069 WP_000872632.1.79074 WP_000872632.1.79098 WP_000872632.1.79155 WP_000872632.1.79164 WP_000872632.1.79204 WP_000872632.1.79280 WP_000872632.1.79397 WP_000872632.1.79456 WP_000872632.1.79532 WP_000872632.1.79547 WP_000872632.1.79654 WP_000872632.1.7970 WP_000872632.1.79722 WP_000872632.1.79772 WP_000872632.1.79880 WP_000872632.1.79916 WP_000872632.1.80065 WP_000872632.1.80103 WP_000872632.1.80273 WP_000872632.1.80282 WP_000872632.1.80354 WP_000872632.1.80368 WP_000872632.1.80386 WP_000872632.1.80400 WP_000872632.1.80462 WP_000872632.1.8049 WP_000872632.1.80492 WP_000872632.1.80569 WP_000872632.1.80664 WP_000872632.1.80696 WP_000872632.1.80984 WP_000872632.1.81131 WP_000872632.1.81187 WP_000872632.1.81262 WP_000872632.1.81268 WP_000872632.1.81269 WP_000872632.1.81271 WP_000872632.1.8131 WP_000872632.1.81333 WP_000872632.1.81342 WP_000872632.1.81364 WP_000872632.1.81494 WP_000872632.1.81557 WP_000872632.1.81676 WP_000872632.1.81681 WP_000872632.1.8170 WP_000872632.1.81763 WP_000872632.1.81855 WP_000872632.1.81921 WP_000872632.1.81931 WP_000872632.1.81936 WP_000872632.1.81949 WP_000872632.1.82070 WP_000872632.1.82076 WP_000872632.1.82131 WP_000872632.1.82156 WP_000872632.1.8218 WP_000872632.1.82180 WP_000872632.1.82201 WP_000872632.1.82214 WP_000872632.1.82225 WP_000872632.1.8240 WP_000872632.1.82408 WP_000872632.1.82416 WP_000872632.1.8242 WP_000872632.1.82456 WP_000872632.1.82465 WP_000872632.1.82473 WP_000872632.1.82553 WP_000872632.1.82670 WP_000872632.1.82731 WP_000872632.1.82812 WP_000872632.1.82850 WP_000872632.1.82872 WP_000872632.1.8294 WP_000872632.1.82959 WP_000872632.1.83007 WP_000872632.1.8304 WP_000872632.1.83180 WP_000872632.1.83229 WP_000872632.1.83235 WP_000872632.1.83290 WP_000872632.1.83333 WP_000872632.1.83657 WP_000872632.1.83677 WP_000872632.1.8375 WP_000872632.1.83923 WP_000872632.1.83994 WP_000872632.1.84 WP_000872632.1.8406 WP_000872632.1.84076 WP_000872632.1.84110 WP_000872632.1.84127 WP_000872632.1.84150 WP_000872632.1.84230 WP_000872632.1.84252 WP_000872632.1.84345 WP_000872632.1.84369 WP_000872632.1.84401 WP_000872632.1.84631 WP_000872632.1.84727 WP_000872632.1.84744 WP_000872632.1.84773 WP_000872632.1.84945 WP_000872632.1.84967 WP_000872632.1.85004 WP_000872632.1.8502 WP_000872632.1.85039 WP_000872632.1.85153 WP_000872632.1.85273 WP_000872632.1.85338 WP_000872632.1.85339 WP_000872632.1.85511 WP_000872632.1.85512 WP_000872632.1.8557 WP_000872632.1.85606 WP_000872632.1.85635 WP_000872632.1.85646 WP_000872632.1.85669 WP_000872632.1.85688 WP_000872632.1.85703 WP_000872632.1.85728 WP_000872632.1.85746 WP_000872632.1.85811 WP_000872632.1.859 WP_000872632.1.85917 WP_000872632.1.85977 WP_000872632.1.860 WP_000872632.1.8605 WP_000872632.1.86084 WP_000872632.1.8610 WP_000872632.1.8614 WP_000872632.1.86156 WP_000872632.1.86323 WP_000872632.1.86342 WP_000872632.1.8640 WP_000872632.1.8642 WP_000872632.1.86426 WP_000872632.1.86489 WP_000872632.1.86530 WP_000872632.1.86663 WP_000872632.1.86770 WP_000872632.1.86794 WP_000872632.1.86800 WP_000872632.1.86811 WP_000872632.1.86815 WP_000872632.1.86945 WP_000872632.1.86989 WP_000872632.1.87023 WP_000872632.1.87034 WP_000872632.1.87041 WP_000872632.1.87136 WP_000872632.1.87155 WP_000872632.1.87258 WP_000872632.1.87293 WP_000872632.1.87420 WP_000872632.1.87528 WP_000872632.1.87560 WP_000872632.1.8760 WP_000872632.1.87600 WP_000872632.1.87609 WP_000872632.1.87612 WP_000872632.1.87615 WP_000872632.1.87653 WP_000872632.1.87659 WP_000872632.1.87698 WP_000872632.1.87706 WP_000872632.1.87739 WP_000872632.1.87741 WP_000872632.1.87742 WP_000872632.1.87852 WP_000872632.1.87949 WP_000872632.1.88025 WP_000872632.1.88026 WP_000872632.1.8805 WP_000872632.1.8806 WP_000872632.1.881 WP_000872632.1.88145 WP_000872632.1.88199 WP_000872632.1.88299 WP_000872632.1.88313 WP_000872632.1.88359 WP_000872632.1.88407 WP_000872632.1.88414 WP_000872632.1.88444 WP_000872632.1.88446 WP_000872632.1.88458 WP_000872632.1.88501 WP_000872632.1.88538 WP_000872632.1.88547 WP_000872632.1.886 WP_000872632.1.88647 WP_000872632.1.88648 WP_000872632.1.88692 WP_000872632.1.88707 WP_000872632.1.88727 WP_000872632.1.88772 WP_000872632.1.88850 WP_000872632.1.8889 WP_000872632.1.88892 WP_000872632.1.88894 WP_000872632.1.89182 WP_000872632.1.89298 WP_000872632.1.89308 WP_000872632.1.89314 WP_000872632.1.89328 WP_000872632.1.89332 WP_000872632.1.89343 WP_000872632.1.89395 WP_000872632.1.8940 WP_000872632.1.89449 WP_000872632.1.8947 WP_000872632.1.89503 WP_000872632.1.89591 WP_000872632.1.89612 WP_000872632.1.89668 WP_000872632.1.89706 WP_000872632.1.89713 WP_000872632.1.89733 WP_000872632.1.89796 WP_000872632.1.89804 WP_000872632.1.89845 WP_000872632.1.89888 WP_000872632.1.89911 WP_000872632.1.8995 WP_000872632.1.89952 WP_000872632.1.90007 WP_000872632.1.9011 WP_000872632.1.90196 WP_000872632.1.90240 WP_000872632.1.90274 WP_000872632.1.90280 WP_000872632.1.90330 WP_000872632.1.90338 WP_000872632.1.90365 WP_000872632.1.90428 WP_000872632.1.90489 WP_000872632.1.90513 WP_000872632.1.90582 WP_000872632.1.90713 WP_000872632.1.90794 WP_000872632.1.90796 WP_000872632.1.90811 WP_000872632.1.9091 WP_000872632.1.91067 WP_000872632.1.91164 WP_000872632.1.91205 WP_000872632.1.91239 WP_000872632.1.91291 WP_000872632.1.91313 WP_000872632.1.9135 WP_000872632.1.91506 WP_000872632.1.91557 WP_000872632.1.91597 WP_000872632.1.91715 WP_000872632.1.9187 WP_000872632.1.91870 WP_000872632.1.92018 WP_000872632.1.92087 WP_000872632.1.92098 WP_000872632.1.92156 WP_000872632.1.92172 WP_000872632.1.92240 WP_000872632.1.92243 WP_000872632.1.92327 WP_000872632.1.92470 WP_000872632.1.92477 WP_000872632.1.92545 WP_000872632.1.92570 WP_000872632.1.92588 WP_000872632.1.926 WP_000872632.1.92633 WP_000872632.1.92676 WP_000872632.1.92705 WP_000872632.1.9271 WP_000872632.1.92734 WP_000872632.1.92810 WP_000872632.1.92823 WP_000872632.1.92987 WP_000872632.1.93007 WP_000872632.1.93022 WP_000872632.1.93103 WP_000872632.1.93105 WP_000872632.1.93111 WP_000872632.1.93121 WP_000872632.1.93168 WP_000872632.1.93184 WP_000872632.1.93221 WP_000872632.1.93223 WP_000872632.1.93239 WP_000872632.1.93302 WP_000872632.1.9336 WP_000872632.1.93387 WP_000872632.1.93469 WP_000872632.1.93511 WP_000872632.1.93512 WP_000872632.1.93635 WP_000872632.1.93657 WP_000872632.1.9374 WP_000872632.1.9375 WP_000872632.1.93754 WP_000872632.1.93780 WP_000872632.1.93828 WP_000872632.1.93843 WP_000872632.1.93875 WP_000872632.1.93909 WP_000872632.1.93919 WP_000872632.1.93938 WP_000872632.1.93984 WP_000872632.1.9399 WP_000872632.1.94017 WP_000872632.1.94079 WP_000872632.1.94097 WP_000872632.1.94107 WP_000872632.1.94142 WP_000872632.1.94215 WP_000872632.1.94303 WP_000872632.1.94365 WP_000872632.1.94390 WP_000872632.1.94415 WP_000872632.1.94492 WP_000872632.1.94510 WP_000872632.1.94527 WP_000872632.1.94573 WP_000872632.1.94579 WP_000872632.1.94586 WP_000872632.1.94593 WP_000872632.1.94650 WP_000872632.1.94659 WP_000872632.1.94662 WP_000872632.1.94700 WP_000872632.1.94745 WP_000872632.1.94782 WP_000872632.1.94815 WP_000872632.1.94820 WP_000872632.1.94850 WP_000872632.1.94851 WP_000872632.1.94864 WP_000872632.1.94952 WP_000872632.1.95006 WP_000872632.1.95055 WP_000872632.1.95076 WP_000872632.1.95099 WP_000872632.1.95165 WP_000872632.1.95239 WP_000872632.1.95246 WP_000872632.1.9525 WP_000872632.1.95255 WP_000872632.1.95265 WP_000872632.1.95338 WP_000872632.1.95412 WP_000872632.1.95530 WP_000872632.1.95547 WP_000872632.1.95590 WP_000872632.1.95625 WP_000872632.1.95675 WP_000872632.1.95716 WP_000872632.1.95776 WP_000872632.1.95884 WP_000872632.1.95890 WP_000872632.1.95906 WP_000872632.1.96025 WP_000872632.1.96044 WP_000872632.1.96054 WP_000872632.1.96094 WP_000872632.1.96127 WP_000872632.1.96144 WP_000872632.1.96188 WP_000872632.1.96211 WP_000872632.1.96212 WP_000872632.1.96319 WP_000872632.1.9633 WP_000872632.1.96359 WP_000872632.1.96539 WP_000872632.1.96552 WP_000872632.1.96610 WP_000872632.1.96625 WP_000872632.1.96635 WP_000872632.1.9664 WP_000872632.1.96675 WP_000872632.1.9670 WP_000872632.1.96750 WP_000872632.1.96792 WP_000872632.1.96801 WP_000872632.1.96803 WP_000872632.1.96925 WP_000872632.1.96938 WP_000872632.1.96946 WP_000872632.1.96957 WP_000872632.1.96978 WP_000872632.1.97026 WP_000872632.1.97028 WP_000872632.1.97079 WP_000872632.1.97154 WP_000872632.1.97184 WP_000872632.1.97287 WP_000872632.1.97291 WP_000872632.1.97441 WP_000872632.1.97497 WP_000872632.1.97505 WP_000872632.1.97599 WP_000872632.1.97606 WP_000872632.1.97615 WP_000872632.1.97646 WP_000872632.1.97690 WP_000872632.1.97819 WP_000872632.1.97840 WP_000872632.1.97938 WP_000872632.1.97986 WP_000872632.1.98036 WP_000872632.1.98080 WP_000872632.1.98086 WP_000872632.1.98158 WP_000872632.1.98263 WP_000872632.1.98418 WP_000872632.1.98448 WP_000872632.1.98457 WP_000872632.1.9850 WP_000872632.1.98502 WP_000872632.1.98607 WP_000872632.1.98731 WP_000872632.1.98762 WP_000872632.1.9877 WP_000872632.1.98801 WP_000872632.1.98818 WP_000872632.1.99163 WP_000872632.1.99335 WP_000872632.1.99350 WP_000872632.1.99360 WP_000872632.1.99363 WP_000872632.1.99369 WP_000872632.1.99388 WP_000872632.1.99397 WP_000872632.1.99463 WP_000872632.1.99483 WP_000872632.1.99546 WP_000872632.1.99579 WP_000872632.1.99595 WP_000872632.1.99671 WP_000872632.1.99676 WP_000872632.1.99764 WP_000872632.1.99829 WP_000872632.1.99837 WP_000872632.1.99841 WP_000872632.1.9992 WP_000872632.1.99996 gi|29144203|ref|NP_807545.1| 209261.t3933 220341.STY4221 AE014613|CDS_4071789-4070623 AL513382|CDS_4087142-4085976 gi|378962106|ref|YP_005219592.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]