SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16762817|ref|NP_458434.1| from Salmonella enterica subsp. enterica serovar Typhi str. CT18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16762817|ref|NP_458434.1|
Domain Number 1 Region: 19-401
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.71e-126
Family GABA-aminotransferase-like 0.000000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16762817|ref|NP_458434.1|
Sequence length 405
Comment acetylornithine aminotransferase [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
Sequence
MATEQTAITRATFDEVILPVYAPADFIPVKGKGSRVWDQQGKEYIDFAGGIAVTALGHCH
PALVEALKSQGETLWHTSNVFTNEPALCLGRKLIDATFAERVLFMNSGTEANETAFKLAR
HYACVRHSPFKTKIIAFQNAFHGRSLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLHAVK
AVMDDHTCAVVVEPIQGEGGVQAATPEFLKGLRDLCDKHQALLVFDEVQCGMGRTGDLFA
YMHYGVTPDILTSAKALGGGFPVSAMLTTQEIASAFHVGSHGSTYGGNPLACAVAGAAFD
IINTPEVLQGIHTKRQQFVQHLQAIDEQFDIFSDIRGMGLLIGAELKPKYKGRARDFLYA
GAEAGVMVLNAGADVMRFAPSLVVEEADINEGMQRFAQAVGKVVA
Download sequence
Identical sequences Q8Z1Z3
gi|488656477|ref|YP_007928280.1| NP_458434.1.84458 WP_000190017.1.100008 WP_000190017.1.100036 WP_000190017.1.100079 WP_000190017.1.100196 WP_000190017.1.100284 WP_000190017.1.100313 WP_000190017.1.100314 WP_000190017.1.100321 WP_000190017.1.100354 WP_000190017.1.100421 WP_000190017.1.100446 WP_000190017.1.100450 WP_000190017.1.100592 WP_000190017.1.100610 WP_000190017.1.100732 WP_000190017.1.100733 WP_000190017.1.100739 WP_000190017.1.100764 WP_000190017.1.100799 WP_000190017.1.100941 WP_000190017.1.100953 WP_000190017.1.101011 WP_000190017.1.10108 WP_000190017.1.101226 WP_000190017.1.10124 WP_000190017.1.101271 WP_000190017.1.101312 WP_000190017.1.101322 WP_000190017.1.101374 WP_000190017.1.101616 WP_000190017.1.101890 WP_000190017.1.101941 WP_000190017.1.102050 WP_000190017.1.102087 WP_000190017.1.10338 WP_000190017.1.1038 WP_000190017.1.104 WP_000190017.1.10401 WP_000190017.1.10428 WP_000190017.1.10459 WP_000190017.1.10475 WP_000190017.1.10511 WP_000190017.1.10514 WP_000190017.1.10530 WP_000190017.1.10532 WP_000190017.1.10547 WP_000190017.1.10595 WP_000190017.1.10642 WP_000190017.1.10654 WP_000190017.1.10677 WP_000190017.1.10857 WP_000190017.1.10873 WP_000190017.1.10926 WP_000190017.1.10936 WP_000190017.1.11012 WP_000190017.1.11055 WP_000190017.1.11126 WP_000190017.1.11142 WP_000190017.1.11239 WP_000190017.1.11253 WP_000190017.1.11314 WP_000190017.1.11385 WP_000190017.1.1142 WP_000190017.1.11426 WP_000190017.1.11429 WP_000190017.1.11557 WP_000190017.1.11567 WP_000190017.1.11638 WP_000190017.1.11883 WP_000190017.1.11908 WP_000190017.1.11914 WP_000190017.1.12040 WP_000190017.1.12061 WP_000190017.1.1207 WP_000190017.1.12141 WP_000190017.1.12172 WP_000190017.1.12192 WP_000190017.1.1224 WP_000190017.1.12364 WP_000190017.1.12398 WP_000190017.1.12441 WP_000190017.1.12581 WP_000190017.1.12620 WP_000190017.1.12648 WP_000190017.1.12683 WP_000190017.1.12726 WP_000190017.1.12727 WP_000190017.1.12741 WP_000190017.1.12834 WP_000190017.1.13108 WP_000190017.1.1321 WP_000190017.1.13268 WP_000190017.1.13291 WP_000190017.1.133 WP_000190017.1.13314 WP_000190017.1.13338 WP_000190017.1.13342 WP_000190017.1.13352 WP_000190017.1.13406 WP_000190017.1.13440 WP_000190017.1.13443 WP_000190017.1.13476 WP_000190017.1.13599 WP_000190017.1.13686 WP_000190017.1.1372 WP_000190017.1.13732 WP_000190017.1.1382 WP_000190017.1.1397 WP_000190017.1.13972 WP_000190017.1.140 WP_000190017.1.1401 WP_000190017.1.1408 WP_000190017.1.14089 WP_000190017.1.14099 WP_000190017.1.14120 WP_000190017.1.14123 WP_000190017.1.14150 WP_000190017.1.14191 WP_000190017.1.14197 WP_000190017.1.14280 WP_000190017.1.14333 WP_000190017.1.14399 WP_000190017.1.14444 WP_000190017.1.14467 WP_000190017.1.14474 WP_000190017.1.14500 WP_000190017.1.14526 WP_000190017.1.14550 WP_000190017.1.14575 WP_000190017.1.14701 WP_000190017.1.14703 WP_000190017.1.14719 WP_000190017.1.1473 WP_000190017.1.14765 WP_000190017.1.14810 WP_000190017.1.14877 WP_000190017.1.14894 WP_000190017.1.14930 WP_000190017.1.14947 WP_000190017.1.14948 WP_000190017.1.15184 WP_000190017.1.15244 WP_000190017.1.15265 WP_000190017.1.15362 WP_000190017.1.15415 WP_000190017.1.15423 WP_000190017.1.15433 WP_000190017.1.15439 WP_000190017.1.15487 WP_000190017.1.15535 WP_000190017.1.15581 WP_000190017.1.15597 WP_000190017.1.15710 WP_000190017.1.15717 WP_000190017.1.15905 WP_000190017.1.15912 WP_000190017.1.15970 WP_000190017.1.16046 WP_000190017.1.16051 WP_000190017.1.16058 WP_000190017.1.16150 WP_000190017.1.16155 WP_000190017.1.1626 WP_000190017.1.16264 WP_000190017.1.16344 WP_000190017.1.16452 WP_000190017.1.16461 WP_000190017.1.16462 WP_000190017.1.16465 WP_000190017.1.16522 WP_000190017.1.16588 WP_000190017.1.16658 WP_000190017.1.16666 WP_000190017.1.16673 WP_000190017.1.1674 WP_000190017.1.16767 WP_000190017.1.16781 WP_000190017.1.16879 WP_000190017.1.16905 WP_000190017.1.16948 WP_000190017.1.17049 WP_000190017.1.17058 WP_000190017.1.17078 WP_000190017.1.17202 WP_000190017.1.17219 WP_000190017.1.1722 WP_000190017.1.17302 WP_000190017.1.17308 WP_000190017.1.17368 WP_000190017.1.17405 WP_000190017.1.17406 WP_000190017.1.17513 WP_000190017.1.17543 WP_000190017.1.17563 WP_000190017.1.17578 WP_000190017.1.17622 WP_000190017.1.17659 WP_000190017.1.17667 WP_000190017.1.17686 WP_000190017.1.17741 WP_000190017.1.17840 WP_000190017.1.17956 WP_000190017.1.18005 WP_000190017.1.1801 WP_000190017.1.18021 WP_000190017.1.18099 WP_000190017.1.18124 WP_000190017.1.18144 WP_000190017.1.18173 WP_000190017.1.18270 WP_000190017.1.18280 WP_000190017.1.18328 WP_000190017.1.18358 WP_000190017.1.18370 WP_000190017.1.18406 WP_000190017.1.18474 WP_000190017.1.18513 WP_000190017.1.18610 WP_000190017.1.18678 WP_000190017.1.18722 WP_000190017.1.18766 WP_000190017.1.1880 WP_000190017.1.1885 WP_000190017.1.18860 WP_000190017.1.18922 WP_000190017.1.18959 WP_000190017.1.19001 WP_000190017.1.19006 WP_000190017.1.19044 WP_000190017.1.19084 WP_000190017.1.19187 WP_000190017.1.19228 WP_000190017.1.19288 WP_000190017.1.19300 WP_000190017.1.19422 WP_000190017.1.19454 WP_000190017.1.19456 WP_000190017.1.19496 WP_000190017.1.19535 WP_000190017.1.19538 WP_000190017.1.19589 WP_000190017.1.19663 WP_000190017.1.19686 WP_000190017.1.19731 WP_000190017.1.19794 WP_000190017.1.1992 WP_000190017.1.19999 WP_000190017.1.20254 WP_000190017.1.20255 WP_000190017.1.20296 WP_000190017.1.20339 WP_000190017.1.20419 WP_000190017.1.20492 WP_000190017.1.2053 WP_000190017.1.20635 WP_000190017.1.20718 WP_000190017.1.2073 WP_000190017.1.20740 WP_000190017.1.20828 WP_000190017.1.2087 WP_000190017.1.20883 WP_000190017.1.20947 WP_000190017.1.20953 WP_000190017.1.21010 WP_000190017.1.2106 WP_000190017.1.21062 WP_000190017.1.21144 WP_000190017.1.21162 WP_000190017.1.21184 WP_000190017.1.21185 WP_000190017.1.21366 WP_000190017.1.21492 WP_000190017.1.2166 WP_000190017.1.21674 WP_000190017.1.21946 WP_000190017.1.21966 WP_000190017.1.22064 WP_000190017.1.22118 WP_000190017.1.22126 WP_000190017.1.2216 WP_000190017.1.22208 WP_000190017.1.2227 WP_000190017.1.22373 WP_000190017.1.22476 WP_000190017.1.22614 WP_000190017.1.22683 WP_000190017.1.2284 WP_000190017.1.22895 WP_000190017.1.22926 WP_000190017.1.22943 WP_000190017.1.22967 WP_000190017.1.23040 WP_000190017.1.23058 WP_000190017.1.23218 WP_000190017.1.2331 WP_000190017.1.2332 WP_000190017.1.23340 WP_000190017.1.2336 WP_000190017.1.23365 WP_000190017.1.23412 WP_000190017.1.23426 WP_000190017.1.23492 WP_000190017.1.23515 WP_000190017.1.23548 WP_000190017.1.23571 WP_000190017.1.23604 WP_000190017.1.23679 WP_000190017.1.23728 WP_000190017.1.2375 WP_000190017.1.23783 WP_000190017.1.23786 WP_000190017.1.23787 WP_000190017.1.23801 WP_000190017.1.24028 WP_000190017.1.24061 WP_000190017.1.24083 WP_000190017.1.24117 WP_000190017.1.24125 WP_000190017.1.24138 WP_000190017.1.24153 WP_000190017.1.24291 WP_000190017.1.24322 WP_000190017.1.24355 WP_000190017.1.24375 WP_000190017.1.24400 WP_000190017.1.24420 WP_000190017.1.24619 WP_000190017.1.24643 WP_000190017.1.24688 WP_000190017.1.24716 WP_000190017.1.2481 WP_000190017.1.24832 WP_000190017.1.24964 WP_000190017.1.25017 WP_000190017.1.25032 WP_000190017.1.25041 WP_000190017.1.25053 WP_000190017.1.25140 WP_000190017.1.25185 WP_000190017.1.25196 WP_000190017.1.25210 WP_000190017.1.25219 WP_000190017.1.25304 WP_000190017.1.25374 WP_000190017.1.25475 WP_000190017.1.25490 WP_000190017.1.25508 WP_000190017.1.25512 WP_000190017.1.25603 WP_000190017.1.2562 WP_000190017.1.25666 WP_000190017.1.25807 WP_000190017.1.25821 WP_000190017.1.25833 WP_000190017.1.25835 WP_000190017.1.25882 WP_000190017.1.25911 WP_000190017.1.25962 WP_000190017.1.25963 WP_000190017.1.26001 WP_000190017.1.26027 WP_000190017.1.26107 WP_000190017.1.2615 WP_000190017.1.26217 WP_000190017.1.26230 WP_000190017.1.26232 WP_000190017.1.26272 WP_000190017.1.26286 WP_000190017.1.26288 WP_000190017.1.26394 WP_000190017.1.26491 WP_000190017.1.2654 WP_000190017.1.26554 WP_000190017.1.26636 WP_000190017.1.26689 WP_000190017.1.2679 WP_000190017.1.26908 WP_000190017.1.2692 WP_000190017.1.26928 WP_000190017.1.270 WP_000190017.1.27008 WP_000190017.1.27027 WP_000190017.1.27070 WP_000190017.1.27077 WP_000190017.1.27086 WP_000190017.1.27087 WP_000190017.1.27111 WP_000190017.1.27115 WP_000190017.1.2713 WP_000190017.1.2717 WP_000190017.1.27228 WP_000190017.1.27282 WP_000190017.1.27285 WP_000190017.1.27309 WP_000190017.1.27329 WP_000190017.1.27361 WP_000190017.1.27565 WP_000190017.1.27595 WP_000190017.1.27598 WP_000190017.1.27706 WP_000190017.1.27775 WP_000190017.1.27785 WP_000190017.1.27900 WP_000190017.1.27928 WP_000190017.1.27945 WP_000190017.1.28004 WP_000190017.1.2809 WP_000190017.1.28155 WP_000190017.1.28198 WP_000190017.1.2822 WP_000190017.1.28229 WP_000190017.1.28384 WP_000190017.1.28386 WP_000190017.1.28395 WP_000190017.1.284 WP_000190017.1.2845 WP_000190017.1.28479 WP_000190017.1.28627 WP_000190017.1.28692 WP_000190017.1.2873 WP_000190017.1.28917 WP_000190017.1.28962 WP_000190017.1.29023 WP_000190017.1.29042 WP_000190017.1.2905 WP_000190017.1.29081 WP_000190017.1.29089 WP_000190017.1.29153 WP_000190017.1.29203 WP_000190017.1.29237 WP_000190017.1.29248 WP_000190017.1.29288 WP_000190017.1.29389 WP_000190017.1.29439 WP_000190017.1.2946 WP_000190017.1.29462 WP_000190017.1.29563 WP_000190017.1.29727 WP_000190017.1.29743 WP_000190017.1.29782 WP_000190017.1.29833 WP_000190017.1.29851 WP_000190017.1.29865 WP_000190017.1.29886 WP_000190017.1.29919 WP_000190017.1.2994 WP_000190017.1.29964 WP_000190017.1.29983 WP_000190017.1.30009 WP_000190017.1.30013 WP_000190017.1.3002 WP_000190017.1.30034 WP_000190017.1.30049 WP_000190017.1.30058 WP_000190017.1.30172 WP_000190017.1.30185 WP_000190017.1.30354 WP_000190017.1.30357 WP_000190017.1.30362 WP_000190017.1.3042 WP_000190017.1.30421 WP_000190017.1.30440 WP_000190017.1.30448 WP_000190017.1.30489 WP_000190017.1.30517 WP_000190017.1.30542 WP_000190017.1.30544 WP_000190017.1.30556 WP_000190017.1.30572 WP_000190017.1.30585 WP_000190017.1.30618 WP_000190017.1.30664 WP_000190017.1.30688 WP_000190017.1.30806 WP_000190017.1.30967 WP_000190017.1.31046 WP_000190017.1.31066 WP_000190017.1.31139 WP_000190017.1.31145 WP_000190017.1.31182 WP_000190017.1.31205 WP_000190017.1.3121 WP_000190017.1.31223 WP_000190017.1.31303 WP_000190017.1.3131 WP_000190017.1.31352 WP_000190017.1.31389 WP_000190017.1.31413 WP_000190017.1.31446 WP_000190017.1.31533 WP_000190017.1.31799 WP_000190017.1.31836 WP_000190017.1.31951 WP_000190017.1.32041 WP_000190017.1.32042 WP_000190017.1.3207 WP_000190017.1.32189 WP_000190017.1.32202 WP_000190017.1.32263 WP_000190017.1.32293 WP_000190017.1.32299 WP_000190017.1.32422 WP_000190017.1.32425 WP_000190017.1.32458 WP_000190017.1.32460 WP_000190017.1.32529 WP_000190017.1.32563 WP_000190017.1.32578 WP_000190017.1.32617 WP_000190017.1.3270 WP_000190017.1.32725 WP_000190017.1.32838 WP_000190017.1.32848 WP_000190017.1.32868 WP_000190017.1.3290 WP_000190017.1.32940 WP_000190017.1.32941 WP_000190017.1.3296 WP_000190017.1.32966 WP_000190017.1.32985 WP_000190017.1.33037 WP_000190017.1.3305 WP_000190017.1.33051 WP_000190017.1.33065 WP_000190017.1.33122 WP_000190017.1.3315 WP_000190017.1.33208 WP_000190017.1.33214 WP_000190017.1.33247 WP_000190017.1.33280 WP_000190017.1.33283 WP_000190017.1.33313 WP_000190017.1.33339 WP_000190017.1.33382 WP_000190017.1.33490 WP_000190017.1.33501 WP_000190017.1.33529 WP_000190017.1.33689 WP_000190017.1.3370 WP_000190017.1.33730 WP_000190017.1.33741 WP_000190017.1.33840 WP_000190017.1.3392 WP_000190017.1.33926 WP_000190017.1.33957 WP_000190017.1.33969 WP_000190017.1.34001 WP_000190017.1.34059 WP_000190017.1.34118 WP_000190017.1.34211 WP_000190017.1.34214 WP_000190017.1.34234 WP_000190017.1.34284 WP_000190017.1.34376 WP_000190017.1.34382 WP_000190017.1.34484 WP_000190017.1.34517 WP_000190017.1.34530 WP_000190017.1.34665 WP_000190017.1.34694 WP_000190017.1.34751 WP_000190017.1.34808 WP_000190017.1.34824 WP_000190017.1.34834 WP_000190017.1.34932 WP_000190017.1.34962 WP_000190017.1.35001 WP_000190017.1.35040 WP_000190017.1.35074 WP_000190017.1.35175 WP_000190017.1.35240 WP_000190017.1.35274 WP_000190017.1.35532 WP_000190017.1.35560 WP_000190017.1.3557 WP_000190017.1.35628 WP_000190017.1.3570 WP_000190017.1.35712 WP_000190017.1.35713 WP_000190017.1.35736 WP_000190017.1.35791 WP_000190017.1.35795 WP_000190017.1.35870 WP_000190017.1.35938 WP_000190017.1.35966 WP_000190017.1.36000 WP_000190017.1.36034 WP_000190017.1.36036 WP_000190017.1.36069 WP_000190017.1.36291 WP_000190017.1.36298 WP_000190017.1.36308 WP_000190017.1.36323 WP_000190017.1.36343 WP_000190017.1.36460 WP_000190017.1.3649 WP_000190017.1.36495 WP_000190017.1.36526 WP_000190017.1.36567 WP_000190017.1.36579 WP_000190017.1.36617 WP_000190017.1.36618 WP_000190017.1.36643 WP_000190017.1.36663 WP_000190017.1.36701 WP_000190017.1.36725 WP_000190017.1.36779 WP_000190017.1.36798 WP_000190017.1.36802 WP_000190017.1.36821 WP_000190017.1.36853 WP_000190017.1.36950 WP_000190017.1.37014 WP_000190017.1.37133 WP_000190017.1.37176 WP_000190017.1.37199 WP_000190017.1.37200 WP_000190017.1.37258 WP_000190017.1.37303 WP_000190017.1.37513 WP_000190017.1.37584 WP_000190017.1.37590 WP_000190017.1.37593 WP_000190017.1.37600 WP_000190017.1.37613 WP_000190017.1.37659 WP_000190017.1.37662 WP_000190017.1.37675 WP_000190017.1.37691 WP_000190017.1.37761 WP_000190017.1.37775 WP_000190017.1.37777 WP_000190017.1.378 WP_000190017.1.379 WP_000190017.1.37911 WP_000190017.1.37941 WP_000190017.1.37985 WP_000190017.1.38061 WP_000190017.1.38064 WP_000190017.1.38108 WP_000190017.1.3816 WP_000190017.1.38207 WP_000190017.1.38261 WP_000190017.1.38266 WP_000190017.1.38310 WP_000190017.1.3834 WP_000190017.1.38351 WP_000190017.1.3838 WP_000190017.1.38381 WP_000190017.1.38440 WP_000190017.1.38486 WP_000190017.1.38515 WP_000190017.1.38595 WP_000190017.1.3860 WP_000190017.1.38642 WP_000190017.1.38734 WP_000190017.1.38877 WP_000190017.1.38983 WP_000190017.1.38996 WP_000190017.1.39056 WP_000190017.1.3907 WP_000190017.1.39105 WP_000190017.1.3914 WP_000190017.1.39147 WP_000190017.1.39161 WP_000190017.1.39210 WP_000190017.1.39235 WP_000190017.1.3931 WP_000190017.1.39435 WP_000190017.1.39502 WP_000190017.1.39530 WP_000190017.1.39619 WP_000190017.1.39620 WP_000190017.1.39624 WP_000190017.1.39659 WP_000190017.1.39667 WP_000190017.1.39775 WP_000190017.1.39879 WP_000190017.1.39890 WP_000190017.1.39941 WP_000190017.1.39945 WP_000190017.1.39947 WP_000190017.1.40095 WP_000190017.1.40097 WP_000190017.1.401 WP_000190017.1.40160 WP_000190017.1.40167 WP_000190017.1.40279 WP_000190017.1.40361 WP_000190017.1.4042 WP_000190017.1.40467 WP_000190017.1.40496 WP_000190017.1.40517 WP_000190017.1.40698 WP_000190017.1.40750 WP_000190017.1.40854 WP_000190017.1.4089 WP_000190017.1.40924 WP_000190017.1.40932 WP_000190017.1.40946 WP_000190017.1.41004 WP_000190017.1.4106 WP_000190017.1.41070 WP_000190017.1.41074 WP_000190017.1.41075 WP_000190017.1.41097 WP_000190017.1.41132 WP_000190017.1.41176 WP_000190017.1.41251 WP_000190017.1.41258 WP_000190017.1.41305 WP_000190017.1.41321 WP_000190017.1.41333 WP_000190017.1.41335 WP_000190017.1.4136 WP_000190017.1.41415 WP_000190017.1.41459 WP_000190017.1.41498 WP_000190017.1.41519 WP_000190017.1.41524 WP_000190017.1.41631 WP_000190017.1.41658 WP_000190017.1.41659 WP_000190017.1.41716 WP_000190017.1.41746 WP_000190017.1.41824 WP_000190017.1.41825 WP_000190017.1.41836 WP_000190017.1.41894 WP_000190017.1.41919 WP_000190017.1.41929 WP_000190017.1.4194 WP_000190017.1.42069 WP_000190017.1.42081 WP_000190017.1.42090 WP_000190017.1.42111 WP_000190017.1.42187 WP_000190017.1.42200 WP_000190017.1.42219 WP_000190017.1.42257 WP_000190017.1.42261 WP_000190017.1.42349 WP_000190017.1.42364 WP_000190017.1.42371 WP_000190017.1.42379 WP_000190017.1.42391 WP_000190017.1.42399 WP_000190017.1.42539 WP_000190017.1.42603 WP_000190017.1.42650 WP_000190017.1.4267 WP_000190017.1.42701 WP_000190017.1.42805 WP_000190017.1.42815 WP_000190017.1.42859 WP_000190017.1.4298 WP_000190017.1.43016 WP_000190017.1.43019 WP_000190017.1.43065 WP_000190017.1.43068 WP_000190017.1.43069 WP_000190017.1.43128 WP_000190017.1.43141 WP_000190017.1.43157 WP_000190017.1.43161 WP_000190017.1.43190 WP_000190017.1.43198 WP_000190017.1.4326 WP_000190017.1.43290 WP_000190017.1.43292 WP_000190017.1.43307 WP_000190017.1.43513 WP_000190017.1.43633 WP_000190017.1.43637 WP_000190017.1.43651 WP_000190017.1.43722 WP_000190017.1.43801 WP_000190017.1.43812 WP_000190017.1.43878 WP_000190017.1.43888 WP_000190017.1.43919 WP_000190017.1.43974 WP_000190017.1.44049 WP_000190017.1.44101 WP_000190017.1.44160 WP_000190017.1.44180 WP_000190017.1.44196 WP_000190017.1.44248 WP_000190017.1.44262 WP_000190017.1.44268 WP_000190017.1.4427 WP_000190017.1.44296 WP_000190017.1.44343 WP_000190017.1.44351 WP_000190017.1.44360 WP_000190017.1.44416 WP_000190017.1.44431 WP_000190017.1.44437 WP_000190017.1.44546 WP_000190017.1.4468 WP_000190017.1.44762 WP_000190017.1.44815 WP_000190017.1.44828 WP_000190017.1.44879 WP_000190017.1.44917 WP_000190017.1.4501 WP_000190017.1.45072 WP_000190017.1.45093 WP_000190017.1.45136 WP_000190017.1.45241 WP_000190017.1.45435 WP_000190017.1.45523 WP_000190017.1.45596 WP_000190017.1.45648 WP_000190017.1.45829 WP_000190017.1.45871 WP_000190017.1.46030 WP_000190017.1.46077 WP_000190017.1.46169 WP_000190017.1.46225 WP_000190017.1.46241 WP_000190017.1.46307 WP_000190017.1.46355 WP_000190017.1.464 WP_000190017.1.46454 WP_000190017.1.46461 WP_000190017.1.46504 WP_000190017.1.46505 WP_000190017.1.46551 WP_000190017.1.46559 WP_000190017.1.46701 WP_000190017.1.46781 WP_000190017.1.46816 WP_000190017.1.46842 WP_000190017.1.4690 WP_000190017.1.46920 WP_000190017.1.46945 WP_000190017.1.47036 WP_000190017.1.47037 WP_000190017.1.47042 WP_000190017.1.47059 WP_000190017.1.47085 WP_000190017.1.47123 WP_000190017.1.47215 WP_000190017.1.47245 WP_000190017.1.47523 WP_000190017.1.47531 WP_000190017.1.47532 WP_000190017.1.47605 WP_000190017.1.47630 WP_000190017.1.4774 WP_000190017.1.47756 WP_000190017.1.4781 WP_000190017.1.47886 WP_000190017.1.47898 WP_000190017.1.48019 WP_000190017.1.48100 WP_000190017.1.48114 WP_000190017.1.48139 WP_000190017.1.48190 WP_000190017.1.48292 WP_000190017.1.48324 WP_000190017.1.48426 WP_000190017.1.48430 WP_000190017.1.48436 WP_000190017.1.48586 WP_000190017.1.4859 WP_000190017.1.48591 WP_000190017.1.48610 WP_000190017.1.48631 WP_000190017.1.48663 WP_000190017.1.48690 WP_000190017.1.48734 WP_000190017.1.48756 WP_000190017.1.48778 WP_000190017.1.48849 WP_000190017.1.48955 WP_000190017.1.48963 WP_000190017.1.48973 WP_000190017.1.49004 WP_000190017.1.49106 WP_000190017.1.49117 WP_000190017.1.49121 WP_000190017.1.4914 WP_000190017.1.49140 WP_000190017.1.49153 WP_000190017.1.49166 WP_000190017.1.49355 WP_000190017.1.49429 WP_000190017.1.49434 WP_000190017.1.49450 WP_000190017.1.495 WP_000190017.1.49545 WP_000190017.1.49703 WP_000190017.1.49769 WP_000190017.1.49846 WP_000190017.1.4991 WP_000190017.1.49947 WP_000190017.1.49959 WP_000190017.1.49997 WP_000190017.1.50014 WP_000190017.1.50030 WP_000190017.1.50043 WP_000190017.1.50103 WP_000190017.1.50158 WP_000190017.1.50247 WP_000190017.1.50308 WP_000190017.1.50309 WP_000190017.1.50387 WP_000190017.1.50406 WP_000190017.1.50468 WP_000190017.1.5051 WP_000190017.1.50566 WP_000190017.1.50570 WP_000190017.1.50626 WP_000190017.1.50726 WP_000190017.1.50771 WP_000190017.1.50875 WP_000190017.1.50885 WP_000190017.1.509 WP_000190017.1.50929 WP_000190017.1.50970 WP_000190017.1.51040 WP_000190017.1.51048 WP_000190017.1.51100 WP_000190017.1.51134 WP_000190017.1.51227 WP_000190017.1.5127 WP_000190017.1.51305 WP_000190017.1.51315 WP_000190017.1.5136 WP_000190017.1.51474 WP_000190017.1.51519 WP_000190017.1.51598 WP_000190017.1.51644 WP_000190017.1.51724 WP_000190017.1.51734 WP_000190017.1.51838 WP_000190017.1.51863 WP_000190017.1.51935 WP_000190017.1.52057 WP_000190017.1.52114 WP_000190017.1.52129 WP_000190017.1.52191 WP_000190017.1.52202 WP_000190017.1.52209 WP_000190017.1.52339 WP_000190017.1.52469 WP_000190017.1.52571 WP_000190017.1.526 WP_000190017.1.52647 WP_000190017.1.52742 WP_000190017.1.52773 WP_000190017.1.52795 WP_000190017.1.52807 WP_000190017.1.52887 WP_000190017.1.53092 WP_000190017.1.53141 WP_000190017.1.53151 WP_000190017.1.53154 WP_000190017.1.53159 WP_000190017.1.53210 WP_000190017.1.53233 WP_000190017.1.53307 WP_000190017.1.53321 WP_000190017.1.53368 WP_000190017.1.53375 WP_000190017.1.53450 WP_000190017.1.5349 WP_000190017.1.53540 WP_000190017.1.53555 WP_000190017.1.53559 WP_000190017.1.5356 WP_000190017.1.53571 WP_000190017.1.5358 WP_000190017.1.53692 WP_000190017.1.53723 WP_000190017.1.5374 WP_000190017.1.53750 WP_000190017.1.53800 WP_000190017.1.53815 WP_000190017.1.53839 WP_000190017.1.53892 WP_000190017.1.53898 WP_000190017.1.53902 WP_000190017.1.53958 WP_000190017.1.53981 WP_000190017.1.53984 WP_000190017.1.54132 WP_000190017.1.54170 WP_000190017.1.54175 WP_000190017.1.54203 WP_000190017.1.54259 WP_000190017.1.5430 WP_000190017.1.54371 WP_000190017.1.54431 WP_000190017.1.54442 WP_000190017.1.54482 WP_000190017.1.54589 WP_000190017.1.54667 WP_000190017.1.54678 WP_000190017.1.54681 WP_000190017.1.54748 WP_000190017.1.5481 WP_000190017.1.54865 WP_000190017.1.54935 WP_000190017.1.54979 WP_000190017.1.55010 WP_000190017.1.55034 WP_000190017.1.55163 WP_000190017.1.55165 WP_000190017.1.55215 WP_000190017.1.55290 WP_000190017.1.55310 WP_000190017.1.55317 WP_000190017.1.55379 WP_000190017.1.5539 WP_000190017.1.55468 WP_000190017.1.55506 WP_000190017.1.55604 WP_000190017.1.55639 WP_000190017.1.55699 WP_000190017.1.55725 WP_000190017.1.55780 WP_000190017.1.55967 WP_000190017.1.56144 WP_000190017.1.56172 WP_000190017.1.5621 WP_000190017.1.56226 WP_000190017.1.56311 WP_000190017.1.56419 WP_000190017.1.56423 WP_000190017.1.56514 WP_000190017.1.56535 WP_000190017.1.56585 WP_000190017.1.56640 WP_000190017.1.56724 WP_000190017.1.56825 WP_000190017.1.56887 WP_000190017.1.56889 WP_000190017.1.56981 WP_000190017.1.57101 WP_000190017.1.57137 WP_000190017.1.57147 WP_000190017.1.57179 WP_000190017.1.57186 WP_000190017.1.57342 WP_000190017.1.57684 WP_000190017.1.57699 WP_000190017.1.57785 WP_000190017.1.57800 WP_000190017.1.57873 WP_000190017.1.57965 WP_000190017.1.57972 WP_000190017.1.58008 WP_000190017.1.58044 WP_000190017.1.58081 WP_000190017.1.5809 WP_000190017.1.58132 WP_000190017.1.58173 WP_000190017.1.58191 WP_000190017.1.58194 WP_000190017.1.58252 WP_000190017.1.58261 WP_000190017.1.58274 WP_000190017.1.58282 WP_000190017.1.58324 WP_000190017.1.58326 WP_000190017.1.5836 WP_000190017.1.58485 WP_000190017.1.58537 WP_000190017.1.58568 WP_000190017.1.58583 WP_000190017.1.58652 WP_000190017.1.58663 WP_000190017.1.58724 WP_000190017.1.5875 WP_000190017.1.58796 WP_000190017.1.58807 WP_000190017.1.58847 WP_000190017.1.58883 WP_000190017.1.58898 WP_000190017.1.58949 WP_000190017.1.58963 WP_000190017.1.58970 WP_000190017.1.58974 WP_000190017.1.59020 WP_000190017.1.59043 WP_000190017.1.59056 WP_000190017.1.59061 WP_000190017.1.59064 WP_000190017.1.59282 WP_000190017.1.59299 WP_000190017.1.59313 WP_000190017.1.5949 WP_000190017.1.59501 WP_000190017.1.59510 WP_000190017.1.5969 WP_000190017.1.59751 WP_000190017.1.59829 WP_000190017.1.59847 WP_000190017.1.59863 WP_000190017.1.59969 WP_000190017.1.59994 WP_000190017.1.60045 WP_000190017.1.60076 WP_000190017.1.60114 WP_000190017.1.60154 WP_000190017.1.60168 WP_000190017.1.60192 WP_000190017.1.60199 WP_000190017.1.60212 WP_000190017.1.60253 WP_000190017.1.60322 WP_000190017.1.60324 WP_000190017.1.60356 WP_000190017.1.6038 WP_000190017.1.60380 WP_000190017.1.6041 WP_000190017.1.60424 WP_000190017.1.60481 WP_000190017.1.605 WP_000190017.1.6058 WP_000190017.1.60584 WP_000190017.1.6060 WP_000190017.1.60676 WP_000190017.1.60708 WP_000190017.1.60725 WP_000190017.1.60783 WP_000190017.1.60792 WP_000190017.1.60807 WP_000190017.1.60882 WP_000190017.1.60889 WP_000190017.1.60950 WP_000190017.1.6104 WP_000190017.1.61044 WP_000190017.1.61076 WP_000190017.1.61123 WP_000190017.1.61147 WP_000190017.1.61168 WP_000190017.1.61210 WP_000190017.1.61357 WP_000190017.1.61511 WP_000190017.1.61539 WP_000190017.1.61542 WP_000190017.1.61553 WP_000190017.1.61649 WP_000190017.1.61652 WP_000190017.1.61697 WP_000190017.1.61809 WP_000190017.1.61877 WP_000190017.1.61920 WP_000190017.1.62124 WP_000190017.1.62199 WP_000190017.1.62223 WP_000190017.1.62302 WP_000190017.1.62314 WP_000190017.1.62323 WP_000190017.1.62338 WP_000190017.1.62380 WP_000190017.1.62411 WP_000190017.1.62436 WP_000190017.1.62475 WP_000190017.1.62536 WP_000190017.1.62640 WP_000190017.1.62686 WP_000190017.1.62751 WP_000190017.1.62825 WP_000190017.1.62913 WP_000190017.1.62932 WP_000190017.1.62960 WP_000190017.1.63016 WP_000190017.1.63025 WP_000190017.1.63069 WP_000190017.1.63087 WP_000190017.1.63169 WP_000190017.1.63297 WP_000190017.1.63448 WP_000190017.1.63514 WP_000190017.1.63583 WP_000190017.1.63592 WP_000190017.1.63663 WP_000190017.1.63736 WP_000190017.1.63816 WP_000190017.1.63876 WP_000190017.1.6389 WP_000190017.1.63901 WP_000190017.1.63955 WP_000190017.1.63963 WP_000190017.1.64032 WP_000190017.1.64087 WP_000190017.1.6415 WP_000190017.1.64293 WP_000190017.1.64332 WP_000190017.1.64376 WP_000190017.1.644 WP_000190017.1.64471 WP_000190017.1.64501 WP_000190017.1.64538 WP_000190017.1.64632 WP_000190017.1.64648 WP_000190017.1.64654 WP_000190017.1.64662 WP_000190017.1.64663 WP_000190017.1.64709 WP_000190017.1.64710 WP_000190017.1.64744 WP_000190017.1.64763 WP_000190017.1.64817 WP_000190017.1.64847 WP_000190017.1.6487 WP_000190017.1.64891 WP_000190017.1.64974 WP_000190017.1.65054 WP_000190017.1.65075 WP_000190017.1.6514 WP_000190017.1.65172 WP_000190017.1.65191 WP_000190017.1.65200 WP_000190017.1.65211 WP_000190017.1.65218 WP_000190017.1.65226 WP_000190017.1.65249 WP_000190017.1.65266 WP_000190017.1.65395 WP_000190017.1.65459 WP_000190017.1.65463 WP_000190017.1.65487 WP_000190017.1.6549 WP_000190017.1.65499 WP_000190017.1.6554 WP_000190017.1.65650 WP_000190017.1.65697 WP_000190017.1.65699 WP_000190017.1.65737 WP_000190017.1.65755 WP_000190017.1.65812 WP_000190017.1.65846 WP_000190017.1.65863 WP_000190017.1.65985 WP_000190017.1.66021 WP_000190017.1.66031 WP_000190017.1.66052 WP_000190017.1.66064 WP_000190017.1.66109 WP_000190017.1.66145 WP_000190017.1.66183 WP_000190017.1.6620 WP_000190017.1.66216 WP_000190017.1.66234 WP_000190017.1.66273 WP_000190017.1.66324 WP_000190017.1.6634 WP_000190017.1.66361 WP_000190017.1.66480 WP_000190017.1.66506 WP_000190017.1.66665 WP_000190017.1.66681 WP_000190017.1.66684 WP_000190017.1.66755 WP_000190017.1.66759 WP_000190017.1.66801 WP_000190017.1.66860 WP_000190017.1.66953 WP_000190017.1.66955 WP_000190017.1.66981 WP_000190017.1.67024 WP_000190017.1.67042 WP_000190017.1.67101 WP_000190017.1.67143 WP_000190017.1.67201 WP_000190017.1.67211 WP_000190017.1.67237 WP_000190017.1.67336 WP_000190017.1.67339 WP_000190017.1.67387 WP_000190017.1.67394 WP_000190017.1.67397 WP_000190017.1.67403 WP_000190017.1.67430 WP_000190017.1.67442 WP_000190017.1.67539 WP_000190017.1.67556 WP_000190017.1.67576 WP_000190017.1.67604 WP_000190017.1.67619 WP_000190017.1.67625 WP_000190017.1.67627 WP_000190017.1.67641 WP_000190017.1.67657 WP_000190017.1.67673 WP_000190017.1.67700 WP_000190017.1.67718 WP_000190017.1.67729 WP_000190017.1.67774 WP_000190017.1.67820 WP_000190017.1.67910 WP_000190017.1.67954 WP_000190017.1.68 WP_000190017.1.68043 WP_000190017.1.68105 WP_000190017.1.68113 WP_000190017.1.68131 WP_000190017.1.68182 WP_000190017.1.6819 WP_000190017.1.68285 WP_000190017.1.68359 WP_000190017.1.68420 WP_000190017.1.68514 WP_000190017.1.68564 WP_000190017.1.68688 WP_000190017.1.68742 WP_000190017.1.68770 WP_000190017.1.68809 WP_000190017.1.68914 WP_000190017.1.69053 WP_000190017.1.69170 WP_000190017.1.69210 WP_000190017.1.69270 WP_000190017.1.69282 WP_000190017.1.69376 WP_000190017.1.69396 WP_000190017.1.69466 WP_000190017.1.69611 WP_000190017.1.69642 WP_000190017.1.69656 WP_000190017.1.69657 WP_000190017.1.69690 WP_000190017.1.69923 WP_000190017.1.69948 WP_000190017.1.69953 WP_000190017.1.70010 WP_000190017.1.70049 WP_000190017.1.70058 WP_000190017.1.70061 WP_000190017.1.70205 WP_000190017.1.70240 WP_000190017.1.70249 WP_000190017.1.70261 WP_000190017.1.70314 WP_000190017.1.7033 WP_000190017.1.70427 WP_000190017.1.70433 WP_000190017.1.70545 WP_000190017.1.70623 WP_000190017.1.70671 WP_000190017.1.70679 WP_000190017.1.70708 WP_000190017.1.70717 WP_000190017.1.70731 WP_000190017.1.70772 WP_000190017.1.70845 WP_000190017.1.70846 WP_000190017.1.70981 WP_000190017.1.70995 WP_000190017.1.71039 WP_000190017.1.71057 WP_000190017.1.71081 WP_000190017.1.71117 WP_000190017.1.71186 WP_000190017.1.71455 WP_000190017.1.71456 WP_000190017.1.71487 WP_000190017.1.71523 WP_000190017.1.71542 WP_000190017.1.71566 WP_000190017.1.71640 WP_000190017.1.71651 WP_000190017.1.71653 WP_000190017.1.71716 WP_000190017.1.71872 WP_000190017.1.71954 WP_000190017.1.71985 WP_000190017.1.72003 WP_000190017.1.72073 WP_000190017.1.72269 WP_000190017.1.72350 WP_000190017.1.72383 WP_000190017.1.72461 WP_000190017.1.72527 WP_000190017.1.7255 WP_000190017.1.72631 WP_000190017.1.72638 WP_000190017.1.72667 WP_000190017.1.72674 WP_000190017.1.72724 WP_000190017.1.72789 WP_000190017.1.72828 WP_000190017.1.72896 WP_000190017.1.72969 WP_000190017.1.72987 WP_000190017.1.73052 WP_000190017.1.7311 WP_000190017.1.73114 WP_000190017.1.73177 WP_000190017.1.73180 WP_000190017.1.73258 WP_000190017.1.73285 WP_000190017.1.7332 WP_000190017.1.7333 WP_000190017.1.73352 WP_000190017.1.73389 WP_000190017.1.73425 WP_000190017.1.73488 WP_000190017.1.73504 WP_000190017.1.7353 WP_000190017.1.73544 WP_000190017.1.73598 WP_000190017.1.7361 WP_000190017.1.73648 WP_000190017.1.73768 WP_000190017.1.73849 WP_000190017.1.73948 WP_000190017.1.73999 WP_000190017.1.74024 WP_000190017.1.74030 WP_000190017.1.74038 WP_000190017.1.74043 WP_000190017.1.74058 WP_000190017.1.74070 WP_000190017.1.74077 WP_000190017.1.74135 WP_000190017.1.74214 WP_000190017.1.74241 WP_000190017.1.74285 WP_000190017.1.7430 WP_000190017.1.74317 WP_000190017.1.74415 WP_000190017.1.74616 WP_000190017.1.74621 WP_000190017.1.74647 WP_000190017.1.74677 WP_000190017.1.74699 WP_000190017.1.74831 WP_000190017.1.74894 WP_000190017.1.74929 WP_000190017.1.74939 WP_000190017.1.74973 WP_000190017.1.7507 WP_000190017.1.75089 WP_000190017.1.75116 WP_000190017.1.75237 WP_000190017.1.75273 WP_000190017.1.75296 WP_000190017.1.75413 WP_000190017.1.75433 WP_000190017.1.75532 WP_000190017.1.75565 WP_000190017.1.75593 WP_000190017.1.75610 WP_000190017.1.75633 WP_000190017.1.75718 WP_000190017.1.75745 WP_000190017.1.75844 WP_000190017.1.75886 WP_000190017.1.75898 WP_000190017.1.76081 WP_000190017.1.76116 WP_000190017.1.76122 WP_000190017.1.76256 WP_000190017.1.76339 WP_000190017.1.76366 WP_000190017.1.76417 WP_000190017.1.7646 WP_000190017.1.76510 WP_000190017.1.76558 WP_000190017.1.76572 WP_000190017.1.76641 WP_000190017.1.76651 WP_000190017.1.76653 WP_000190017.1.76788 WP_000190017.1.76854 WP_000190017.1.76916 WP_000190017.1.76932 WP_000190017.1.76973 WP_000190017.1.76988 WP_000190017.1.77016 WP_000190017.1.77087 WP_000190017.1.77090 WP_000190017.1.77111 WP_000190017.1.77299 WP_000190017.1.77384 WP_000190017.1.77501 WP_000190017.1.77512 WP_000190017.1.77513 WP_000190017.1.77563 WP_000190017.1.77702 WP_000190017.1.77713 WP_000190017.1.7772 WP_000190017.1.77825 WP_000190017.1.77837 WP_000190017.1.77900 WP_000190017.1.77923 WP_000190017.1.77975 WP_000190017.1.78035 WP_000190017.1.78048 WP_000190017.1.78107 WP_000190017.1.78166 WP_000190017.1.78192 WP_000190017.1.78195 WP_000190017.1.78291 WP_000190017.1.78309 WP_000190017.1.78320 WP_000190017.1.78382 WP_000190017.1.78388 WP_000190017.1.78410 WP_000190017.1.78626 WP_000190017.1.78661 WP_000190017.1.78674 WP_000190017.1.78676 WP_000190017.1.78761 WP_000190017.1.789 WP_000190017.1.78993 WP_000190017.1.79012 WP_000190017.1.79069 WP_000190017.1.79074 WP_000190017.1.79098 WP_000190017.1.79155 WP_000190017.1.79164 WP_000190017.1.79204 WP_000190017.1.79280 WP_000190017.1.79397 WP_000190017.1.79456 WP_000190017.1.79532 WP_000190017.1.79547 WP_000190017.1.79654 WP_000190017.1.7970 WP_000190017.1.79722 WP_000190017.1.79772 WP_000190017.1.79880 WP_000190017.1.79916 WP_000190017.1.80065 WP_000190017.1.80103 WP_000190017.1.80273 WP_000190017.1.80282 WP_000190017.1.80354 WP_000190017.1.80368 WP_000190017.1.80386 WP_000190017.1.80400 WP_000190017.1.80462 WP_000190017.1.8049 WP_000190017.1.80492 WP_000190017.1.80569 WP_000190017.1.80664 WP_000190017.1.80696 WP_000190017.1.80984 WP_000190017.1.81131 WP_000190017.1.81187 WP_000190017.1.81262 WP_000190017.1.81268 WP_000190017.1.81269 WP_000190017.1.81271 WP_000190017.1.8131 WP_000190017.1.81333 WP_000190017.1.81342 WP_000190017.1.81364 WP_000190017.1.81494 WP_000190017.1.81557 WP_000190017.1.81676 WP_000190017.1.81681 WP_000190017.1.8170 WP_000190017.1.81763 WP_000190017.1.81855 WP_000190017.1.81921 WP_000190017.1.81931 WP_000190017.1.81936 WP_000190017.1.81949 WP_000190017.1.82070 WP_000190017.1.82076 WP_000190017.1.82131 WP_000190017.1.82156 WP_000190017.1.8218 WP_000190017.1.82180 WP_000190017.1.82201 WP_000190017.1.82214 WP_000190017.1.82225 WP_000190017.1.8240 WP_000190017.1.82408 WP_000190017.1.82416 WP_000190017.1.8242 WP_000190017.1.82456 WP_000190017.1.82465 WP_000190017.1.82473 WP_000190017.1.82553 WP_000190017.1.82646 WP_000190017.1.82670 WP_000190017.1.82731 WP_000190017.1.82812 WP_000190017.1.82850 WP_000190017.1.82872 WP_000190017.1.8294 WP_000190017.1.82959 WP_000190017.1.83007 WP_000190017.1.8304 WP_000190017.1.83180 WP_000190017.1.83229 WP_000190017.1.83235 WP_000190017.1.83290 WP_000190017.1.83333 WP_000190017.1.83657 WP_000190017.1.83677 WP_000190017.1.8375 WP_000190017.1.83923 WP_000190017.1.83994 WP_000190017.1.84 WP_000190017.1.8406 WP_000190017.1.84076 WP_000190017.1.84110 WP_000190017.1.84127 WP_000190017.1.84150 WP_000190017.1.84230 WP_000190017.1.84252 WP_000190017.1.8431 WP_000190017.1.84345 WP_000190017.1.84369 WP_000190017.1.84401 WP_000190017.1.84435 WP_000190017.1.84567 WP_000190017.1.84631 WP_000190017.1.84727 WP_000190017.1.84744 WP_000190017.1.84773 WP_000190017.1.84945 WP_000190017.1.84967 WP_000190017.1.85004 WP_000190017.1.8502 WP_000190017.1.85039 WP_000190017.1.85153 WP_000190017.1.85273 WP_000190017.1.85338 WP_000190017.1.85339 WP_000190017.1.85511 WP_000190017.1.85512 WP_000190017.1.8557 WP_000190017.1.85606 WP_000190017.1.85635 WP_000190017.1.85646 WP_000190017.1.85665 WP_000190017.1.85669 WP_000190017.1.85688 WP_000190017.1.85703 WP_000190017.1.85728 WP_000190017.1.85746 WP_000190017.1.85811 WP_000190017.1.859 WP_000190017.1.85917 WP_000190017.1.8594 WP_000190017.1.85977 WP_000190017.1.860 WP_000190017.1.8605 WP_000190017.1.86084 WP_000190017.1.8610 WP_000190017.1.8614 WP_000190017.1.86156 WP_000190017.1.86323 WP_000190017.1.86342 WP_000190017.1.8640 WP_000190017.1.8642 WP_000190017.1.86426 WP_000190017.1.86489 WP_000190017.1.86530 WP_000190017.1.86663 WP_000190017.1.86770 WP_000190017.1.86794 WP_000190017.1.86800 WP_000190017.1.86811 WP_000190017.1.86815 WP_000190017.1.86945 WP_000190017.1.86989 WP_000190017.1.87023 WP_000190017.1.87034 WP_000190017.1.87041 WP_000190017.1.87136 WP_000190017.1.87155 WP_000190017.1.87258 WP_000190017.1.87293 WP_000190017.1.87420 WP_000190017.1.87528 WP_000190017.1.87560 WP_000190017.1.8760 WP_000190017.1.87600 WP_000190017.1.87609 WP_000190017.1.87612 WP_000190017.1.87615 WP_000190017.1.87653 WP_000190017.1.87659 WP_000190017.1.87698 WP_000190017.1.87706 WP_000190017.1.87739 WP_000190017.1.87741 WP_000190017.1.87742 WP_000190017.1.87852 WP_000190017.1.87949 WP_000190017.1.88025 WP_000190017.1.88026 WP_000190017.1.8805 WP_000190017.1.8806 WP_000190017.1.881 WP_000190017.1.88145 WP_000190017.1.88199 WP_000190017.1.88299 WP_000190017.1.88313 WP_000190017.1.88359 WP_000190017.1.88407 WP_000190017.1.88414 WP_000190017.1.88444 WP_000190017.1.88446 WP_000190017.1.88458 WP_000190017.1.88501 WP_000190017.1.88538 WP_000190017.1.88547 WP_000190017.1.886 WP_000190017.1.88647 WP_000190017.1.88648 WP_000190017.1.88692 WP_000190017.1.88707 WP_000190017.1.88727 WP_000190017.1.88772 WP_000190017.1.88850 WP_000190017.1.8889 WP_000190017.1.88892 WP_000190017.1.88894 WP_000190017.1.89182 WP_000190017.1.89298 WP_000190017.1.89308 WP_000190017.1.89314 WP_000190017.1.89328 WP_000190017.1.89332 WP_000190017.1.89343 WP_000190017.1.89395 WP_000190017.1.8940 WP_000190017.1.89449 WP_000190017.1.8947 WP_000190017.1.89503 WP_000190017.1.89591 WP_000190017.1.89612 WP_000190017.1.89668 WP_000190017.1.89706 WP_000190017.1.89713 WP_000190017.1.89733 WP_000190017.1.89796 WP_000190017.1.89804 WP_000190017.1.89845 WP_000190017.1.89888 WP_000190017.1.89911 WP_000190017.1.8995 WP_000190017.1.89952 WP_000190017.1.90007 WP_000190017.1.9011 WP_000190017.1.90196 WP_000190017.1.90240 WP_000190017.1.90274 WP_000190017.1.90280 WP_000190017.1.90330 WP_000190017.1.90338 WP_000190017.1.90365 WP_000190017.1.90428 WP_000190017.1.90489 WP_000190017.1.90513 WP_000190017.1.90582 WP_000190017.1.90713 WP_000190017.1.90794 WP_000190017.1.90796 WP_000190017.1.90811 WP_000190017.1.9091 WP_000190017.1.91067 WP_000190017.1.91205 WP_000190017.1.91239 WP_000190017.1.91291 WP_000190017.1.91313 WP_000190017.1.9135 WP_000190017.1.91506 WP_000190017.1.91557 WP_000190017.1.91597 WP_000190017.1.91715 WP_000190017.1.9187 WP_000190017.1.91870 WP_000190017.1.92018 WP_000190017.1.92087 WP_000190017.1.92098 WP_000190017.1.92156 WP_000190017.1.92172 WP_000190017.1.92240 WP_000190017.1.92243 WP_000190017.1.92327 WP_000190017.1.92470 WP_000190017.1.92477 WP_000190017.1.92545 WP_000190017.1.92570 WP_000190017.1.92588 WP_000190017.1.926 WP_000190017.1.92633 WP_000190017.1.92649 WP_000190017.1.92676 WP_000190017.1.92705 WP_000190017.1.9271 WP_000190017.1.92734 WP_000190017.1.92810 WP_000190017.1.92823 WP_000190017.1.92987 WP_000190017.1.93007 WP_000190017.1.93022 WP_000190017.1.93103 WP_000190017.1.93105 WP_000190017.1.93111 WP_000190017.1.93121 WP_000190017.1.93168 WP_000190017.1.93184 WP_000190017.1.93221 WP_000190017.1.93223 WP_000190017.1.93239 WP_000190017.1.93302 WP_000190017.1.9336 WP_000190017.1.93387 WP_000190017.1.93469 WP_000190017.1.93511 WP_000190017.1.93512 WP_000190017.1.93635 WP_000190017.1.93657 WP_000190017.1.9375 WP_000190017.1.93754 WP_000190017.1.93780 WP_000190017.1.93828 WP_000190017.1.93842 WP_000190017.1.93843 WP_000190017.1.93875 WP_000190017.1.93909 WP_000190017.1.93919 WP_000190017.1.93938 WP_000190017.1.93984 WP_000190017.1.9399 WP_000190017.1.94017 WP_000190017.1.94079 WP_000190017.1.94097 WP_000190017.1.94107 WP_000190017.1.94142 WP_000190017.1.94215 WP_000190017.1.94303 WP_000190017.1.94365 WP_000190017.1.94390 WP_000190017.1.94415 WP_000190017.1.94492 WP_000190017.1.94510 WP_000190017.1.94527 WP_000190017.1.94573 WP_000190017.1.94579 WP_000190017.1.94586 WP_000190017.1.94593 WP_000190017.1.94650 WP_000190017.1.94659 WP_000190017.1.94662 WP_000190017.1.94700 WP_000190017.1.94745 WP_000190017.1.94782 WP_000190017.1.94815 WP_000190017.1.94820 WP_000190017.1.94850 WP_000190017.1.94851 WP_000190017.1.94864 WP_000190017.1.94952 WP_000190017.1.95006 WP_000190017.1.95055 WP_000190017.1.95076 WP_000190017.1.95099 WP_000190017.1.95165 WP_000190017.1.95239 WP_000190017.1.95246 WP_000190017.1.9525 WP_000190017.1.95255 WP_000190017.1.95265 WP_000190017.1.95338 WP_000190017.1.95412 WP_000190017.1.95530 WP_000190017.1.95547 WP_000190017.1.95590 WP_000190017.1.95625 WP_000190017.1.95675 WP_000190017.1.95716 WP_000190017.1.95776 WP_000190017.1.95884 WP_000190017.1.95890 WP_000190017.1.95906 WP_000190017.1.96025 WP_000190017.1.96044 WP_000190017.1.96054 WP_000190017.1.96094 WP_000190017.1.96127 WP_000190017.1.96144 WP_000190017.1.96188 WP_000190017.1.96211 WP_000190017.1.96212 WP_000190017.1.96319 WP_000190017.1.9633 WP_000190017.1.96359 WP_000190017.1.96539 WP_000190017.1.96552 WP_000190017.1.96610 WP_000190017.1.96625 WP_000190017.1.96635 WP_000190017.1.9664 WP_000190017.1.96675 WP_000190017.1.9670 WP_000190017.1.96750 WP_000190017.1.96792 WP_000190017.1.96801 WP_000190017.1.96803 WP_000190017.1.96925 WP_000190017.1.96938 WP_000190017.1.96946 WP_000190017.1.96957 WP_000190017.1.96978 WP_000190017.1.97026 WP_000190017.1.97028 WP_000190017.1.97079 WP_000190017.1.97154 WP_000190017.1.97184 WP_000190017.1.97287 WP_000190017.1.97291 WP_000190017.1.97422 WP_000190017.1.97441 WP_000190017.1.97497 WP_000190017.1.97505 WP_000190017.1.97599 WP_000190017.1.97606 WP_000190017.1.97615 WP_000190017.1.97646 WP_000190017.1.97690 WP_000190017.1.97819 WP_000190017.1.97840 WP_000190017.1.97938 WP_000190017.1.97986 WP_000190017.1.98036 WP_000190017.1.98080 WP_000190017.1.98086 WP_000190017.1.98158 WP_000190017.1.98263 WP_000190017.1.98418 WP_000190017.1.98448 WP_000190017.1.98457 WP_000190017.1.9850 WP_000190017.1.98502 WP_000190017.1.98607 WP_000190017.1.98731 WP_000190017.1.98762 WP_000190017.1.9877 WP_000190017.1.98801 WP_000190017.1.98818 WP_000190017.1.99163 WP_000190017.1.99335 WP_000190017.1.99350 WP_000190017.1.99360 WP_000190017.1.99363 WP_000190017.1.99369 WP_000190017.1.99388 WP_000190017.1.99397 WP_000190017.1.99463 WP_000190017.1.99483 WP_000190017.1.99546 WP_000190017.1.99579 WP_000190017.1.99595 WP_000190017.1.99671 WP_000190017.1.99676 WP_000190017.1.99764 WP_000190017.1.99829 WP_000190017.1.99837 WP_000190017.1.99841 WP_000190017.1.9992 WP_000190017.1.99996 gi|29144304|ref|NP_807646.1| AE014613|CDS_4194576-4195793 AL513382|CDS_4209929-4211146 gi|16762817|ref|NP_458434.1| gi|378962219|ref|YP_005219705.1| 209261.t4037 220341.STY4328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]