SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16763246|ref|NP_458863.1| from Salmonella enterica subsp. enterica serovar Typhi str. CT18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16763246|ref|NP_458863.1|
Domain Number 1 Region: 6-367
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.33e-31
Family Cystathionine synthase-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16763246|ref|NP_458863.1|
Sequence length 372
Comment hypothetical protein STY4785 [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
Sequence
MPSIFEKYQLKQVINASGRMTALGVSTPRPEVIDAAMAGMNQYFEMKDLVNKTGEYIAKL
LEVEGATVVSCASAGLAQSVAAVLVQDSDWLLENLHVTPIENNEIVLPKGHNVNFGAPVG
TMVALGGGKLVEAGYANECSAAQLAAAITPRTAAILYIKSHHCVQKSMLSVEQAAVVART
HNLPLIVDTAAEEDLQCYYRVGADLVIYSGAKAIEGPTSGLVIGKTQYVEWVKRQSAGIG
RAMKVGKEGIVGLTCAIELYLRAQKESGAEMVEKMAPFIDTLNTFNGVSARVVWDSAGRD
IARTEIKFDEAVTGIATGDLVDALKQGEYAIYFRGYKANEGIIEADVRSVDRAQLAIVAR
RIGEVINQEKQA
Download sequence
Identical sequences Q8Z141
AE014613|CDS_4626551-4627669 AL513382|CDS_4643662-4644780 gi|29144725|ref|NP_808067.1| 209261.t4480 220341.STY4785 NP_458863.1.84458 WP_001139189.1.100008 WP_001139189.1.100036 WP_001139189.1.100079 WP_001139189.1.100196 WP_001139189.1.100284 WP_001139189.1.100313 WP_001139189.1.100314 WP_001139189.1.100321 WP_001139189.1.100354 WP_001139189.1.100421 WP_001139189.1.100446 WP_001139189.1.100450 WP_001139189.1.100592 WP_001139189.1.100610 WP_001139189.1.100732 WP_001139189.1.100733 WP_001139189.1.100739 WP_001139189.1.100764 WP_001139189.1.100799 WP_001139189.1.100941 WP_001139189.1.100953 WP_001139189.1.101011 WP_001139189.1.10108 WP_001139189.1.101226 WP_001139189.1.10124 WP_001139189.1.101271 WP_001139189.1.101312 WP_001139189.1.101322 WP_001139189.1.101374 WP_001139189.1.101616 WP_001139189.1.101890 WP_001139189.1.101941 WP_001139189.1.102050 WP_001139189.1.102087 WP_001139189.1.10338 WP_001139189.1.1038 WP_001139189.1.104 WP_001139189.1.10401 WP_001139189.1.10428 WP_001139189.1.10459 WP_001139189.1.10475 WP_001139189.1.10511 WP_001139189.1.10514 WP_001139189.1.10530 WP_001139189.1.10532 WP_001139189.1.10547 WP_001139189.1.10595 WP_001139189.1.10642 WP_001139189.1.10654 WP_001139189.1.10677 WP_001139189.1.10857 WP_001139189.1.10873 WP_001139189.1.10926 WP_001139189.1.10936 WP_001139189.1.11012 WP_001139189.1.11055 WP_001139189.1.11126 WP_001139189.1.11142 WP_001139189.1.11239 WP_001139189.1.11253 WP_001139189.1.11314 WP_001139189.1.11385 WP_001139189.1.1142 WP_001139189.1.11426 WP_001139189.1.11429 WP_001139189.1.11557 WP_001139189.1.11567 WP_001139189.1.11638 WP_001139189.1.11883 WP_001139189.1.11908 WP_001139189.1.11914 WP_001139189.1.12040 WP_001139189.1.12061 WP_001139189.1.1207 WP_001139189.1.12141 WP_001139189.1.12172 WP_001139189.1.12192 WP_001139189.1.1224 WP_001139189.1.12364 WP_001139189.1.12398 WP_001139189.1.12441 WP_001139189.1.12581 WP_001139189.1.12620 WP_001139189.1.12648 WP_001139189.1.12683 WP_001139189.1.12726 WP_001139189.1.12727 WP_001139189.1.12741 WP_001139189.1.12834 WP_001139189.1.13108 WP_001139189.1.13161 WP_001139189.1.1321 WP_001139189.1.13268 WP_001139189.1.13291 WP_001139189.1.133 WP_001139189.1.13314 WP_001139189.1.13338 WP_001139189.1.13342 WP_001139189.1.13352 WP_001139189.1.13406 WP_001139189.1.13440 WP_001139189.1.13443 WP_001139189.1.13476 WP_001139189.1.13599 WP_001139189.1.13686 WP_001139189.1.1372 WP_001139189.1.13732 WP_001139189.1.1382 WP_001139189.1.1397 WP_001139189.1.13972 WP_001139189.1.140 WP_001139189.1.1401 WP_001139189.1.1408 WP_001139189.1.14089 WP_001139189.1.14099 WP_001139189.1.14120 WP_001139189.1.14123 WP_001139189.1.14150 WP_001139189.1.14191 WP_001139189.1.14197 WP_001139189.1.14280 WP_001139189.1.14333 WP_001139189.1.14399 WP_001139189.1.14444 WP_001139189.1.14467 WP_001139189.1.14474 WP_001139189.1.14500 WP_001139189.1.14526 WP_001139189.1.14550 WP_001139189.1.14701 WP_001139189.1.14703 WP_001139189.1.14719 WP_001139189.1.1473 WP_001139189.1.14765 WP_001139189.1.14810 WP_001139189.1.14877 WP_001139189.1.14894 WP_001139189.1.14930 WP_001139189.1.14947 WP_001139189.1.14948 WP_001139189.1.15184 WP_001139189.1.15244 WP_001139189.1.15265 WP_001139189.1.15362 WP_001139189.1.15415 WP_001139189.1.15423 WP_001139189.1.15433 WP_001139189.1.15439 WP_001139189.1.15487 WP_001139189.1.15535 WP_001139189.1.15581 WP_001139189.1.15597 WP_001139189.1.15710 WP_001139189.1.15717 WP_001139189.1.15905 WP_001139189.1.15912 WP_001139189.1.15970 WP_001139189.1.16046 WP_001139189.1.16051 WP_001139189.1.16058 WP_001139189.1.16150 WP_001139189.1.16155 WP_001139189.1.1626 WP_001139189.1.16264 WP_001139189.1.16344 WP_001139189.1.16452 WP_001139189.1.16461 WP_001139189.1.16462 WP_001139189.1.16465 WP_001139189.1.16588 WP_001139189.1.16658 WP_001139189.1.16666 WP_001139189.1.16673 WP_001139189.1.1674 WP_001139189.1.16767 WP_001139189.1.16781 WP_001139189.1.16879 WP_001139189.1.16893 WP_001139189.1.16905 WP_001139189.1.16948 WP_001139189.1.17049 WP_001139189.1.17058 WP_001139189.1.17078 WP_001139189.1.17202 WP_001139189.1.17219 WP_001139189.1.1722 WP_001139189.1.17302 WP_001139189.1.17308 WP_001139189.1.17368 WP_001139189.1.17405 WP_001139189.1.17406 WP_001139189.1.17513 WP_001139189.1.17543 WP_001139189.1.17563 WP_001139189.1.17578 WP_001139189.1.17622 WP_001139189.1.17659 WP_001139189.1.17667 WP_001139189.1.17686 WP_001139189.1.17741 WP_001139189.1.17840 WP_001139189.1.17956 WP_001139189.1.18005 WP_001139189.1.1801 WP_001139189.1.18021 WP_001139189.1.18099 WP_001139189.1.18124 WP_001139189.1.18144 WP_001139189.1.18173 WP_001139189.1.18270 WP_001139189.1.18280 WP_001139189.1.18328 WP_001139189.1.18358 WP_001139189.1.18370 WP_001139189.1.18406 WP_001139189.1.18474 WP_001139189.1.18513 WP_001139189.1.18610 WP_001139189.1.18678 WP_001139189.1.18722 WP_001139189.1.18766 WP_001139189.1.1880 WP_001139189.1.1885 WP_001139189.1.18860 WP_001139189.1.18922 WP_001139189.1.18959 WP_001139189.1.19001 WP_001139189.1.19006 WP_001139189.1.19044 WP_001139189.1.19084 WP_001139189.1.19187 WP_001139189.1.19228 WP_001139189.1.19288 WP_001139189.1.19300 WP_001139189.1.19422 WP_001139189.1.19454 WP_001139189.1.19456 WP_001139189.1.19496 WP_001139189.1.19535 WP_001139189.1.19538 WP_001139189.1.19589 WP_001139189.1.19663 WP_001139189.1.19686 WP_001139189.1.19731 WP_001139189.1.19794 WP_001139189.1.1992 WP_001139189.1.19999 WP_001139189.1.20254 WP_001139189.1.20255 WP_001139189.1.20296 WP_001139189.1.20339 WP_001139189.1.20419 WP_001139189.1.20465 WP_001139189.1.20492 WP_001139189.1.2053 WP_001139189.1.20635 WP_001139189.1.20718 WP_001139189.1.2073 WP_001139189.1.20740 WP_001139189.1.20828 WP_001139189.1.2087 WP_001139189.1.20883 WP_001139189.1.20947 WP_001139189.1.20953 WP_001139189.1.21010 WP_001139189.1.2106 WP_001139189.1.21062 WP_001139189.1.21144 WP_001139189.1.21162 WP_001139189.1.21184 WP_001139189.1.21185 WP_001139189.1.21366 WP_001139189.1.21492 WP_001139189.1.21674 WP_001139189.1.21946 WP_001139189.1.21966 WP_001139189.1.22064 WP_001139189.1.22118 WP_001139189.1.22126 WP_001139189.1.2216 WP_001139189.1.22208 WP_001139189.1.2227 WP_001139189.1.22373 WP_001139189.1.22476 WP_001139189.1.22614 WP_001139189.1.22652 WP_001139189.1.22683 WP_001139189.1.2284 WP_001139189.1.22895 WP_001139189.1.22926 WP_001139189.1.22943 WP_001139189.1.22967 WP_001139189.1.23040 WP_001139189.1.23058 WP_001139189.1.23218 WP_001139189.1.2331 WP_001139189.1.2332 WP_001139189.1.23340 WP_001139189.1.2336 WP_001139189.1.23365 WP_001139189.1.23412 WP_001139189.1.23426 WP_001139189.1.23492 WP_001139189.1.23515 WP_001139189.1.23548 WP_001139189.1.23571 WP_001139189.1.23604 WP_001139189.1.23679 WP_001139189.1.23728 WP_001139189.1.2375 WP_001139189.1.23783 WP_001139189.1.23786 WP_001139189.1.23787 WP_001139189.1.23801 WP_001139189.1.24028 WP_001139189.1.24061 WP_001139189.1.24083 WP_001139189.1.24117 WP_001139189.1.24125 WP_001139189.1.24138 WP_001139189.1.24153 WP_001139189.1.24291 WP_001139189.1.24322 WP_001139189.1.24355 WP_001139189.1.24375 WP_001139189.1.24400 WP_001139189.1.24420 WP_001139189.1.24619 WP_001139189.1.24643 WP_001139189.1.24688 WP_001139189.1.24716 WP_001139189.1.2481 WP_001139189.1.24832 WP_001139189.1.24964 WP_001139189.1.25017 WP_001139189.1.25032 WP_001139189.1.25041 WP_001139189.1.25053 WP_001139189.1.25140 WP_001139189.1.25185 WP_001139189.1.25196 WP_001139189.1.25210 WP_001139189.1.25219 WP_001139189.1.25304 WP_001139189.1.25374 WP_001139189.1.25475 WP_001139189.1.25490 WP_001139189.1.25508 WP_001139189.1.25512 WP_001139189.1.25603 WP_001139189.1.2562 WP_001139189.1.25666 WP_001139189.1.25807 WP_001139189.1.25821 WP_001139189.1.25833 WP_001139189.1.25835 WP_001139189.1.25882 WP_001139189.1.25911 WP_001139189.1.25962 WP_001139189.1.25963 WP_001139189.1.26001 WP_001139189.1.26027 WP_001139189.1.26107 WP_001139189.1.2615 WP_001139189.1.26217 WP_001139189.1.26230 WP_001139189.1.26232 WP_001139189.1.26272 WP_001139189.1.26286 WP_001139189.1.26288 WP_001139189.1.26394 WP_001139189.1.26491 WP_001139189.1.2654 WP_001139189.1.26554 WP_001139189.1.26636 WP_001139189.1.26689 WP_001139189.1.2679 WP_001139189.1.26908 WP_001139189.1.2692 WP_001139189.1.26928 WP_001139189.1.270 WP_001139189.1.27008 WP_001139189.1.27027 WP_001139189.1.27070 WP_001139189.1.27077 WP_001139189.1.27086 WP_001139189.1.27087 WP_001139189.1.27111 WP_001139189.1.27115 WP_001139189.1.2713 WP_001139189.1.2717 WP_001139189.1.27228 WP_001139189.1.27282 WP_001139189.1.27285 WP_001139189.1.27309 WP_001139189.1.27329 WP_001139189.1.27361 WP_001139189.1.27565 WP_001139189.1.27595 WP_001139189.1.27598 WP_001139189.1.27706 WP_001139189.1.27775 WP_001139189.1.27785 WP_001139189.1.27900 WP_001139189.1.27928 WP_001139189.1.27945 WP_001139189.1.28004 WP_001139189.1.2809 WP_001139189.1.28155 WP_001139189.1.28198 WP_001139189.1.2822 WP_001139189.1.28229 WP_001139189.1.28384 WP_001139189.1.28386 WP_001139189.1.28395 WP_001139189.1.284 WP_001139189.1.2845 WP_001139189.1.28479 WP_001139189.1.28627 WP_001139189.1.28692 WP_001139189.1.2873 WP_001139189.1.28917 WP_001139189.1.28962 WP_001139189.1.29023 WP_001139189.1.29042 WP_001139189.1.2905 WP_001139189.1.2907 WP_001139189.1.29081 WP_001139189.1.29089 WP_001139189.1.29153 WP_001139189.1.29203 WP_001139189.1.29237 WP_001139189.1.29248 WP_001139189.1.29288 WP_001139189.1.29389 WP_001139189.1.29439 WP_001139189.1.2946 WP_001139189.1.29462 WP_001139189.1.29563 WP_001139189.1.29727 WP_001139189.1.29743 WP_001139189.1.29782 WP_001139189.1.29833 WP_001139189.1.29851 WP_001139189.1.29865 WP_001139189.1.29886 WP_001139189.1.29919 WP_001139189.1.2994 WP_001139189.1.29964 WP_001139189.1.29983 WP_001139189.1.30009 WP_001139189.1.30013 WP_001139189.1.3002 WP_001139189.1.30034 WP_001139189.1.30049 WP_001139189.1.30058 WP_001139189.1.30172 WP_001139189.1.30185 WP_001139189.1.30354 WP_001139189.1.30357 WP_001139189.1.30362 WP_001139189.1.3042 WP_001139189.1.30421 WP_001139189.1.30440 WP_001139189.1.30448 WP_001139189.1.30489 WP_001139189.1.30517 WP_001139189.1.30542 WP_001139189.1.30544 WP_001139189.1.30556 WP_001139189.1.30572 WP_001139189.1.30585 WP_001139189.1.30618 WP_001139189.1.30664 WP_001139189.1.30688 WP_001139189.1.30806 WP_001139189.1.30967 WP_001139189.1.31046 WP_001139189.1.31066 WP_001139189.1.31078 WP_001139189.1.31139 WP_001139189.1.31145 WP_001139189.1.31182 WP_001139189.1.31205 WP_001139189.1.3121 WP_001139189.1.31223 WP_001139189.1.31303 WP_001139189.1.3131 WP_001139189.1.31352 WP_001139189.1.31389 WP_001139189.1.31413 WP_001139189.1.31446 WP_001139189.1.31533 WP_001139189.1.31799 WP_001139189.1.31836 WP_001139189.1.31951 WP_001139189.1.32041 WP_001139189.1.32042 WP_001139189.1.3207 WP_001139189.1.32189 WP_001139189.1.32202 WP_001139189.1.32263 WP_001139189.1.32293 WP_001139189.1.32299 WP_001139189.1.32422 WP_001139189.1.32425 WP_001139189.1.32458 WP_001139189.1.32460 WP_001139189.1.32529 WP_001139189.1.32563 WP_001139189.1.32578 WP_001139189.1.32617 WP_001139189.1.3270 WP_001139189.1.32725 WP_001139189.1.32838 WP_001139189.1.32848 WP_001139189.1.32868 WP_001139189.1.3290 WP_001139189.1.32940 WP_001139189.1.32941 WP_001139189.1.3296 WP_001139189.1.32966 WP_001139189.1.32985 WP_001139189.1.33037 WP_001139189.1.3305 WP_001139189.1.33051 WP_001139189.1.33065 WP_001139189.1.33122 WP_001139189.1.3315 WP_001139189.1.33208 WP_001139189.1.33214 WP_001139189.1.33247 WP_001139189.1.33280 WP_001139189.1.33283 WP_001139189.1.33313 WP_001139189.1.33339 WP_001139189.1.33382 WP_001139189.1.33490 WP_001139189.1.33501 WP_001139189.1.33529 WP_001139189.1.33689 WP_001139189.1.3370 WP_001139189.1.33730 WP_001139189.1.33741 WP_001139189.1.33840 WP_001139189.1.3392 WP_001139189.1.33926 WP_001139189.1.33957 WP_001139189.1.33969 WP_001139189.1.34001 WP_001139189.1.34059 WP_001139189.1.34118 WP_001139189.1.34211 WP_001139189.1.34214 WP_001139189.1.34234 WP_001139189.1.34284 WP_001139189.1.34376 WP_001139189.1.34382 WP_001139189.1.34484 WP_001139189.1.34517 WP_001139189.1.34530 WP_001139189.1.34665 WP_001139189.1.34694 WP_001139189.1.34751 WP_001139189.1.34808 WP_001139189.1.34824 WP_001139189.1.34834 WP_001139189.1.34932 WP_001139189.1.34962 WP_001139189.1.35001 WP_001139189.1.35040 WP_001139189.1.35074 WP_001139189.1.35175 WP_001139189.1.35240 WP_001139189.1.35274 WP_001139189.1.35532 WP_001139189.1.35560 WP_001139189.1.3557 WP_001139189.1.35628 WP_001139189.1.3570 WP_001139189.1.35712 WP_001139189.1.35713 WP_001139189.1.35736 WP_001139189.1.35791 WP_001139189.1.35795 WP_001139189.1.35870 WP_001139189.1.35916 WP_001139189.1.35938 WP_001139189.1.35966 WP_001139189.1.36000 WP_001139189.1.36034 WP_001139189.1.36036 WP_001139189.1.36069 WP_001139189.1.36291 WP_001139189.1.36298 WP_001139189.1.36308 WP_001139189.1.36323 WP_001139189.1.36343 WP_001139189.1.36460 WP_001139189.1.3649 WP_001139189.1.36495 WP_001139189.1.36526 WP_001139189.1.36567 WP_001139189.1.36579 WP_001139189.1.36617 WP_001139189.1.36618 WP_001139189.1.36643 WP_001139189.1.36663 WP_001139189.1.36701 WP_001139189.1.36725 WP_001139189.1.36779 WP_001139189.1.36798 WP_001139189.1.36802 WP_001139189.1.36821 WP_001139189.1.36853 WP_001139189.1.36950 WP_001139189.1.37014 WP_001139189.1.37133 WP_001139189.1.37176 WP_001139189.1.37199 WP_001139189.1.37200 WP_001139189.1.37258 WP_001139189.1.37303 WP_001139189.1.37513 WP_001139189.1.37584 WP_001139189.1.37590 WP_001139189.1.37593 WP_001139189.1.37600 WP_001139189.1.37613 WP_001139189.1.37659 WP_001139189.1.37662 WP_001139189.1.37675 WP_001139189.1.37691 WP_001139189.1.37761 WP_001139189.1.37775 WP_001139189.1.37777 WP_001139189.1.378 WP_001139189.1.379 WP_001139189.1.37911 WP_001139189.1.37941 WP_001139189.1.37985 WP_001139189.1.38061 WP_001139189.1.38064 WP_001139189.1.38108 WP_001139189.1.3816 WP_001139189.1.38207 WP_001139189.1.38261 WP_001139189.1.38266 WP_001139189.1.38310 WP_001139189.1.3834 WP_001139189.1.38351 WP_001139189.1.3838 WP_001139189.1.38381 WP_001139189.1.38440 WP_001139189.1.38486 WP_001139189.1.38515 WP_001139189.1.38595 WP_001139189.1.3860 WP_001139189.1.38642 WP_001139189.1.38734 WP_001139189.1.38877 WP_001139189.1.38983 WP_001139189.1.38996 WP_001139189.1.39056 WP_001139189.1.3907 WP_001139189.1.39105 WP_001139189.1.3914 WP_001139189.1.39147 WP_001139189.1.39161 WP_001139189.1.39210 WP_001139189.1.39235 WP_001139189.1.3931 WP_001139189.1.39435 WP_001139189.1.39502 WP_001139189.1.39530 WP_001139189.1.39619 WP_001139189.1.39620 WP_001139189.1.39624 WP_001139189.1.39659 WP_001139189.1.39667 WP_001139189.1.39775 WP_001139189.1.39879 WP_001139189.1.39890 WP_001139189.1.39941 WP_001139189.1.39945 WP_001139189.1.39947 WP_001139189.1.40095 WP_001139189.1.40097 WP_001139189.1.401 WP_001139189.1.40160 WP_001139189.1.40167 WP_001139189.1.40279 WP_001139189.1.40361 WP_001139189.1.4042 WP_001139189.1.40467 WP_001139189.1.40496 WP_001139189.1.40517 WP_001139189.1.40698 WP_001139189.1.40750 WP_001139189.1.40763 WP_001139189.1.40854 WP_001139189.1.4089 WP_001139189.1.40924 WP_001139189.1.40932 WP_001139189.1.40946 WP_001139189.1.41004 WP_001139189.1.4106 WP_001139189.1.41070 WP_001139189.1.41074 WP_001139189.1.41075 WP_001139189.1.41097 WP_001139189.1.41132 WP_001139189.1.41176 WP_001139189.1.41251 WP_001139189.1.41258 WP_001139189.1.41305 WP_001139189.1.41321 WP_001139189.1.41333 WP_001139189.1.41335 WP_001139189.1.4136 WP_001139189.1.41415 WP_001139189.1.41459 WP_001139189.1.41498 WP_001139189.1.41519 WP_001139189.1.41524 WP_001139189.1.41631 WP_001139189.1.41658 WP_001139189.1.41659 WP_001139189.1.41716 WP_001139189.1.41746 WP_001139189.1.41824 WP_001139189.1.41825 WP_001139189.1.41836 WP_001139189.1.41894 WP_001139189.1.41919 WP_001139189.1.41929 WP_001139189.1.4194 WP_001139189.1.42069 WP_001139189.1.42081 WP_001139189.1.42090 WP_001139189.1.42111 WP_001139189.1.42187 WP_001139189.1.42200 WP_001139189.1.42219 WP_001139189.1.42257 WP_001139189.1.42261 WP_001139189.1.42349 WP_001139189.1.42364 WP_001139189.1.42371 WP_001139189.1.42379 WP_001139189.1.42391 WP_001139189.1.42399 WP_001139189.1.42539 WP_001139189.1.42603 WP_001139189.1.42650 WP_001139189.1.4267 WP_001139189.1.42701 WP_001139189.1.42805 WP_001139189.1.42815 WP_001139189.1.42859 WP_001139189.1.4298 WP_001139189.1.43008 WP_001139189.1.43016 WP_001139189.1.43019 WP_001139189.1.43065 WP_001139189.1.43068 WP_001139189.1.43069 WP_001139189.1.43128 WP_001139189.1.43141 WP_001139189.1.43157 WP_001139189.1.43161 WP_001139189.1.43190 WP_001139189.1.43198 WP_001139189.1.4326 WP_001139189.1.43290 WP_001139189.1.43292 WP_001139189.1.43307 WP_001139189.1.43513 WP_001139189.1.43633 WP_001139189.1.43637 WP_001139189.1.43651 WP_001139189.1.43722 WP_001139189.1.43801 WP_001139189.1.43812 WP_001139189.1.43878 WP_001139189.1.43888 WP_001139189.1.43919 WP_001139189.1.43974 WP_001139189.1.44049 WP_001139189.1.44101 WP_001139189.1.44160 WP_001139189.1.44180 WP_001139189.1.44196 WP_001139189.1.44248 WP_001139189.1.44262 WP_001139189.1.44268 WP_001139189.1.4427 WP_001139189.1.44296 WP_001139189.1.44351 WP_001139189.1.44360 WP_001139189.1.44416 WP_001139189.1.44431 WP_001139189.1.44437 WP_001139189.1.44546 WP_001139189.1.4468 WP_001139189.1.44762 WP_001139189.1.44815 WP_001139189.1.44828 WP_001139189.1.44879 WP_001139189.1.44917 WP_001139189.1.4501 WP_001139189.1.45072 WP_001139189.1.45093 WP_001139189.1.45136 WP_001139189.1.45241 WP_001139189.1.45435 WP_001139189.1.45523 WP_001139189.1.45596 WP_001139189.1.45648 WP_001139189.1.45829 WP_001139189.1.45871 WP_001139189.1.46030 WP_001139189.1.46077 WP_001139189.1.46169 WP_001139189.1.46225 WP_001139189.1.46241 WP_001139189.1.46307 WP_001139189.1.46355 WP_001139189.1.464 WP_001139189.1.46454 WP_001139189.1.46461 WP_001139189.1.46504 WP_001139189.1.46505 WP_001139189.1.46559 WP_001139189.1.46701 WP_001139189.1.46781 WP_001139189.1.46816 WP_001139189.1.46842 WP_001139189.1.4690 WP_001139189.1.46920 WP_001139189.1.46945 WP_001139189.1.47036 WP_001139189.1.47037 WP_001139189.1.47042 WP_001139189.1.47059 WP_001139189.1.47085 WP_001139189.1.47123 WP_001139189.1.47215 WP_001139189.1.47245 WP_001139189.1.47523 WP_001139189.1.47531 WP_001139189.1.47532 WP_001139189.1.47605 WP_001139189.1.47630 WP_001139189.1.4774 WP_001139189.1.47756 WP_001139189.1.4781 WP_001139189.1.47886 WP_001139189.1.47898 WP_001139189.1.48019 WP_001139189.1.48100 WP_001139189.1.48114 WP_001139189.1.48139 WP_001139189.1.48190 WP_001139189.1.48292 WP_001139189.1.48324 WP_001139189.1.48426 WP_001139189.1.48430 WP_001139189.1.48436 WP_001139189.1.48586 WP_001139189.1.4859 WP_001139189.1.48591 WP_001139189.1.48610 WP_001139189.1.48631 WP_001139189.1.48663 WP_001139189.1.48690 WP_001139189.1.48734 WP_001139189.1.48756 WP_001139189.1.48778 WP_001139189.1.48849 WP_001139189.1.48955 WP_001139189.1.48963 WP_001139189.1.48973 WP_001139189.1.49004 WP_001139189.1.49106 WP_001139189.1.49117 WP_001139189.1.49121 WP_001139189.1.4914 WP_001139189.1.49140 WP_001139189.1.49153 WP_001139189.1.49166 WP_001139189.1.49355 WP_001139189.1.49429 WP_001139189.1.49434 WP_001139189.1.49450 WP_001139189.1.495 WP_001139189.1.49545 WP_001139189.1.49703 WP_001139189.1.49769 WP_001139189.1.49846 WP_001139189.1.4991 WP_001139189.1.49947 WP_001139189.1.49959 WP_001139189.1.49997 WP_001139189.1.50014 WP_001139189.1.50030 WP_001139189.1.50043 WP_001139189.1.50103 WP_001139189.1.50158 WP_001139189.1.50247 WP_001139189.1.50308 WP_001139189.1.50309 WP_001139189.1.50387 WP_001139189.1.50406 WP_001139189.1.50468 WP_001139189.1.5051 WP_001139189.1.50566 WP_001139189.1.50570 WP_001139189.1.50626 WP_001139189.1.50726 WP_001139189.1.50771 WP_001139189.1.50875 WP_001139189.1.50885 WP_001139189.1.509 WP_001139189.1.50929 WP_001139189.1.50970 WP_001139189.1.51040 WP_001139189.1.51048 WP_001139189.1.51100 WP_001139189.1.51134 WP_001139189.1.51227 WP_001139189.1.5127 WP_001139189.1.51305 WP_001139189.1.51315 WP_001139189.1.5136 WP_001139189.1.51474 WP_001139189.1.51519 WP_001139189.1.51598 WP_001139189.1.51644 WP_001139189.1.51724 WP_001139189.1.51734 WP_001139189.1.51838 WP_001139189.1.51863 WP_001139189.1.51935 WP_001139189.1.52057 WP_001139189.1.52114 WP_001139189.1.52129 WP_001139189.1.52191 WP_001139189.1.52202 WP_001139189.1.52209 WP_001139189.1.52339 WP_001139189.1.52469 WP_001139189.1.52571 WP_001139189.1.526 WP_001139189.1.52647 WP_001139189.1.52742 WP_001139189.1.52773 WP_001139189.1.52795 WP_001139189.1.52807 WP_001139189.1.52887 WP_001139189.1.53092 WP_001139189.1.53141 WP_001139189.1.53151 WP_001139189.1.53154 WP_001139189.1.53159 WP_001139189.1.53210 WP_001139189.1.53233 WP_001139189.1.53307 WP_001139189.1.53321 WP_001139189.1.53368 WP_001139189.1.53375 WP_001139189.1.53450 WP_001139189.1.5349 WP_001139189.1.53540 WP_001139189.1.53555 WP_001139189.1.53559 WP_001139189.1.5356 WP_001139189.1.53571 WP_001139189.1.5358 WP_001139189.1.53692 WP_001139189.1.53723 WP_001139189.1.5374 WP_001139189.1.53750 WP_001139189.1.53800 WP_001139189.1.53815 WP_001139189.1.53839 WP_001139189.1.53892 WP_001139189.1.53898 WP_001139189.1.53902 WP_001139189.1.53958 WP_001139189.1.53981 WP_001139189.1.53984 WP_001139189.1.54132 WP_001139189.1.54170 WP_001139189.1.54175 WP_001139189.1.54203 WP_001139189.1.54259 WP_001139189.1.5430 WP_001139189.1.54371 WP_001139189.1.54431 WP_001139189.1.54442 WP_001139189.1.54482 WP_001139189.1.54589 WP_001139189.1.54667 WP_001139189.1.54678 WP_001139189.1.54681 WP_001139189.1.54748 WP_001139189.1.5481 WP_001139189.1.54865 WP_001139189.1.54935 WP_001139189.1.54979 WP_001139189.1.55010 WP_001139189.1.55034 WP_001139189.1.55163 WP_001139189.1.55165 WP_001139189.1.55215 WP_001139189.1.55290 WP_001139189.1.55310 WP_001139189.1.55317 WP_001139189.1.55379 WP_001139189.1.5539 WP_001139189.1.55468 WP_001139189.1.55506 WP_001139189.1.55604 WP_001139189.1.55639 WP_001139189.1.55699 WP_001139189.1.55725 WP_001139189.1.55780 WP_001139189.1.55967 WP_001139189.1.56144 WP_001139189.1.56172 WP_001139189.1.5621 WP_001139189.1.56226 WP_001139189.1.56311 WP_001139189.1.56419 WP_001139189.1.56423 WP_001139189.1.56514 WP_001139189.1.56535 WP_001139189.1.56585 WP_001139189.1.56640 WP_001139189.1.56724 WP_001139189.1.56825 WP_001139189.1.56887 WP_001139189.1.56889 WP_001139189.1.56981 WP_001139189.1.57101 WP_001139189.1.57137 WP_001139189.1.57147 WP_001139189.1.57179 WP_001139189.1.57186 WP_001139189.1.57342 WP_001139189.1.57684 WP_001139189.1.57699 WP_001139189.1.57785 WP_001139189.1.57800 WP_001139189.1.57873 WP_001139189.1.57965 WP_001139189.1.57972 WP_001139189.1.58008 WP_001139189.1.58044 WP_001139189.1.58081 WP_001139189.1.5809 WP_001139189.1.58132 WP_001139189.1.58173 WP_001139189.1.58191 WP_001139189.1.58194 WP_001139189.1.58252 WP_001139189.1.58261 WP_001139189.1.58274 WP_001139189.1.58324 WP_001139189.1.58326 WP_001139189.1.5836 WP_001139189.1.58485 WP_001139189.1.58537 WP_001139189.1.58568 WP_001139189.1.58583 WP_001139189.1.58652 WP_001139189.1.58663 WP_001139189.1.58724 WP_001139189.1.5875 WP_001139189.1.58796 WP_001139189.1.58807 WP_001139189.1.58847 WP_001139189.1.58883 WP_001139189.1.58898 WP_001139189.1.58949 WP_001139189.1.58970 WP_001139189.1.58974 WP_001139189.1.59020 WP_001139189.1.59043 WP_001139189.1.59056 WP_001139189.1.59061 WP_001139189.1.59064 WP_001139189.1.59282 WP_001139189.1.59299 WP_001139189.1.59313 WP_001139189.1.5949 WP_001139189.1.59501 WP_001139189.1.59510 WP_001139189.1.5969 WP_001139189.1.59751 WP_001139189.1.59827 WP_001139189.1.59829 WP_001139189.1.59847 WP_001139189.1.59863 WP_001139189.1.59969 WP_001139189.1.59994 WP_001139189.1.60045 WP_001139189.1.60076 WP_001139189.1.60114 WP_001139189.1.60154 WP_001139189.1.60168 WP_001139189.1.60192 WP_001139189.1.60199 WP_001139189.1.60212 WP_001139189.1.60253 WP_001139189.1.60322 WP_001139189.1.60324 WP_001139189.1.60356 WP_001139189.1.6038 WP_001139189.1.60380 WP_001139189.1.6041 WP_001139189.1.60424 WP_001139189.1.60481 WP_001139189.1.605 WP_001139189.1.6058 WP_001139189.1.60584 WP_001139189.1.6060 WP_001139189.1.60676 WP_001139189.1.60708 WP_001139189.1.60725 WP_001139189.1.60783 WP_001139189.1.60792 WP_001139189.1.60807 WP_001139189.1.60882 WP_001139189.1.60889 WP_001139189.1.60950 WP_001139189.1.6104 WP_001139189.1.61044 WP_001139189.1.61076 WP_001139189.1.61123 WP_001139189.1.61147 WP_001139189.1.61168 WP_001139189.1.61210 WP_001139189.1.61357 WP_001139189.1.61511 WP_001139189.1.61539 WP_001139189.1.61542 WP_001139189.1.61553 WP_001139189.1.61649 WP_001139189.1.61652 WP_001139189.1.61697 WP_001139189.1.61809 WP_001139189.1.61877 WP_001139189.1.61920 WP_001139189.1.62124 WP_001139189.1.62199 WP_001139189.1.62223 WP_001139189.1.62302 WP_001139189.1.62314 WP_001139189.1.62323 WP_001139189.1.62333 WP_001139189.1.62338 WP_001139189.1.62380 WP_001139189.1.62411 WP_001139189.1.62436 WP_001139189.1.62475 WP_001139189.1.62536 WP_001139189.1.62640 WP_001139189.1.62686 WP_001139189.1.62751 WP_001139189.1.62825 WP_001139189.1.62913 WP_001139189.1.62932 WP_001139189.1.62960 WP_001139189.1.63016 WP_001139189.1.63025 WP_001139189.1.63069 WP_001139189.1.63087 WP_001139189.1.63169 WP_001139189.1.63297 WP_001139189.1.63448 WP_001139189.1.63514 WP_001139189.1.63583 WP_001139189.1.63592 WP_001139189.1.63663 WP_001139189.1.63736 WP_001139189.1.63816 WP_001139189.1.63876 WP_001139189.1.6389 WP_001139189.1.63901 WP_001139189.1.63955 WP_001139189.1.63963 WP_001139189.1.64032 WP_001139189.1.64087 WP_001139189.1.6415 WP_001139189.1.64293 WP_001139189.1.64332 WP_001139189.1.64376 WP_001139189.1.644 WP_001139189.1.64471 WP_001139189.1.64501 WP_001139189.1.64538 WP_001139189.1.64632 WP_001139189.1.64648 WP_001139189.1.64654 WP_001139189.1.64662 WP_001139189.1.64663 WP_001139189.1.64709 WP_001139189.1.64710 WP_001139189.1.64744 WP_001139189.1.64763 WP_001139189.1.64817 WP_001139189.1.64847 WP_001139189.1.6487 WP_001139189.1.64891 WP_001139189.1.64974 WP_001139189.1.65054 WP_001139189.1.65075 WP_001139189.1.6514 WP_001139189.1.65172 WP_001139189.1.65191 WP_001139189.1.65200 WP_001139189.1.65211 WP_001139189.1.65218 WP_001139189.1.65226 WP_001139189.1.65249 WP_001139189.1.65266 WP_001139189.1.65395 WP_001139189.1.65459 WP_001139189.1.65463 WP_001139189.1.65487 WP_001139189.1.6549 WP_001139189.1.65499 WP_001139189.1.6554 WP_001139189.1.65650 WP_001139189.1.65697 WP_001139189.1.65699 WP_001139189.1.65737 WP_001139189.1.65755 WP_001139189.1.65812 WP_001139189.1.65846 WP_001139189.1.65863 WP_001139189.1.65985 WP_001139189.1.66021 WP_001139189.1.66031 WP_001139189.1.66052 WP_001139189.1.66064 WP_001139189.1.66109 WP_001139189.1.66145 WP_001139189.1.66183 WP_001139189.1.6620 WP_001139189.1.66234 WP_001139189.1.66273 WP_001139189.1.66324 WP_001139189.1.6634 WP_001139189.1.66361 WP_001139189.1.66480 WP_001139189.1.66506 WP_001139189.1.66665 WP_001139189.1.66681 WP_001139189.1.66684 WP_001139189.1.66755 WP_001139189.1.66759 WP_001139189.1.66801 WP_001139189.1.66860 WP_001139189.1.66953 WP_001139189.1.66955 WP_001139189.1.66981 WP_001139189.1.67024 WP_001139189.1.67042 WP_001139189.1.67101 WP_001139189.1.67143 WP_001139189.1.67201 WP_001139189.1.67211 WP_001139189.1.67237 WP_001139189.1.67336 WP_001139189.1.67339 WP_001139189.1.67387 WP_001139189.1.67394 WP_001139189.1.67397 WP_001139189.1.67403 WP_001139189.1.67430 WP_001139189.1.67442 WP_001139189.1.67539 WP_001139189.1.67556 WP_001139189.1.67576 WP_001139189.1.67604 WP_001139189.1.67619 WP_001139189.1.67625 WP_001139189.1.67627 WP_001139189.1.67641 WP_001139189.1.67657 WP_001139189.1.67673 WP_001139189.1.67700 WP_001139189.1.67718 WP_001139189.1.67729 WP_001139189.1.67774 WP_001139189.1.67820 WP_001139189.1.67910 WP_001139189.1.67954 WP_001139189.1.68 WP_001139189.1.68043 WP_001139189.1.68105 WP_001139189.1.68113 WP_001139189.1.68131 WP_001139189.1.68182 WP_001139189.1.6819 WP_001139189.1.68285 WP_001139189.1.68359 WP_001139189.1.68420 WP_001139189.1.68514 WP_001139189.1.68564 WP_001139189.1.68688 WP_001139189.1.68742 WP_001139189.1.68809 WP_001139189.1.68914 WP_001139189.1.69053 WP_001139189.1.69170 WP_001139189.1.69210 WP_001139189.1.69270 WP_001139189.1.69282 WP_001139189.1.69376 WP_001139189.1.69396 WP_001139189.1.69466 WP_001139189.1.69611 WP_001139189.1.69642 WP_001139189.1.69656 WP_001139189.1.69657 WP_001139189.1.69690 WP_001139189.1.69923 WP_001139189.1.69948 WP_001139189.1.69953 WP_001139189.1.70010 WP_001139189.1.70049 WP_001139189.1.70058 WP_001139189.1.70061 WP_001139189.1.70205 WP_001139189.1.70240 WP_001139189.1.70249 WP_001139189.1.70261 WP_001139189.1.70314 WP_001139189.1.7033 WP_001139189.1.70427 WP_001139189.1.70433 WP_001139189.1.70545 WP_001139189.1.70623 WP_001139189.1.70671 WP_001139189.1.70679 WP_001139189.1.70708 WP_001139189.1.70717 WP_001139189.1.70731 WP_001139189.1.70772 WP_001139189.1.70845 WP_001139189.1.70846 WP_001139189.1.70981 WP_001139189.1.70995 WP_001139189.1.71039 WP_001139189.1.71057 WP_001139189.1.71081 WP_001139189.1.71117 WP_001139189.1.71186 WP_001139189.1.71455 WP_001139189.1.71456 WP_001139189.1.71487 WP_001139189.1.71523 WP_001139189.1.71542 WP_001139189.1.71566 WP_001139189.1.71640 WP_001139189.1.71651 WP_001139189.1.71653 WP_001139189.1.71716 WP_001139189.1.71872 WP_001139189.1.71950 WP_001139189.1.71954 WP_001139189.1.71985 WP_001139189.1.72003 WP_001139189.1.72073 WP_001139189.1.72269 WP_001139189.1.72350 WP_001139189.1.72383 WP_001139189.1.72461 WP_001139189.1.72527 WP_001139189.1.7255 WP_001139189.1.72631 WP_001139189.1.72638 WP_001139189.1.72667 WP_001139189.1.72674 WP_001139189.1.72724 WP_001139189.1.72789 WP_001139189.1.72828 WP_001139189.1.72896 WP_001139189.1.72969 WP_001139189.1.72987 WP_001139189.1.73052 WP_001139189.1.7311 WP_001139189.1.73114 WP_001139189.1.73177 WP_001139189.1.73180 WP_001139189.1.73258 WP_001139189.1.73285 WP_001139189.1.7332 WP_001139189.1.7333 WP_001139189.1.73352 WP_001139189.1.73389 WP_001139189.1.73425 WP_001139189.1.73488 WP_001139189.1.73504 WP_001139189.1.7353 WP_001139189.1.73544 WP_001139189.1.73598 WP_001139189.1.7361 WP_001139189.1.73648 WP_001139189.1.73768 WP_001139189.1.73849 WP_001139189.1.73948 WP_001139189.1.73999 WP_001139189.1.74024 WP_001139189.1.74030 WP_001139189.1.74038 WP_001139189.1.74043 WP_001139189.1.74058 WP_001139189.1.74070 WP_001139189.1.74077 WP_001139189.1.74135 WP_001139189.1.74214 WP_001139189.1.74241 WP_001139189.1.74285 WP_001139189.1.7430 WP_001139189.1.74317 WP_001139189.1.74415 WP_001139189.1.74616 WP_001139189.1.74621 WP_001139189.1.74647 WP_001139189.1.74677 WP_001139189.1.74699 WP_001139189.1.74831 WP_001139189.1.74894 WP_001139189.1.74929 WP_001139189.1.74939 WP_001139189.1.74973 WP_001139189.1.7507 WP_001139189.1.75089 WP_001139189.1.75116 WP_001139189.1.75237 WP_001139189.1.75273 WP_001139189.1.75296 WP_001139189.1.75413 WP_001139189.1.75433 WP_001139189.1.75532 WP_001139189.1.75565 WP_001139189.1.75593 WP_001139189.1.75610 WP_001139189.1.75633 WP_001139189.1.75718 WP_001139189.1.75745 WP_001139189.1.75844 WP_001139189.1.75886 WP_001139189.1.75898 WP_001139189.1.76081 WP_001139189.1.76116 WP_001139189.1.76122 WP_001139189.1.76339 WP_001139189.1.76366 WP_001139189.1.76417 WP_001139189.1.7646 WP_001139189.1.76510 WP_001139189.1.76558 WP_001139189.1.76572 WP_001139189.1.76641 WP_001139189.1.76651 WP_001139189.1.76653 WP_001139189.1.76788 WP_001139189.1.76854 WP_001139189.1.76916 WP_001139189.1.76932 WP_001139189.1.76973 WP_001139189.1.76988 WP_001139189.1.77016 WP_001139189.1.77087 WP_001139189.1.77090 WP_001139189.1.77111 WP_001139189.1.77299 WP_001139189.1.77384 WP_001139189.1.77501 WP_001139189.1.77512 WP_001139189.1.77513 WP_001139189.1.77563 WP_001139189.1.77702 WP_001139189.1.77713 WP_001139189.1.7772 WP_001139189.1.77825 WP_001139189.1.77837 WP_001139189.1.77900 WP_001139189.1.77923 WP_001139189.1.77975 WP_001139189.1.78035 WP_001139189.1.78048 WP_001139189.1.78107 WP_001139189.1.78166 WP_001139189.1.78192 WP_001139189.1.78195 WP_001139189.1.78291 WP_001139189.1.78309 WP_001139189.1.78320 WP_001139189.1.78382 WP_001139189.1.78388 WP_001139189.1.78410 WP_001139189.1.7862 WP_001139189.1.78626 WP_001139189.1.78661 WP_001139189.1.78674 WP_001139189.1.78676 WP_001139189.1.78761 WP_001139189.1.789 WP_001139189.1.78993 WP_001139189.1.79012 WP_001139189.1.79069 WP_001139189.1.79074 WP_001139189.1.79098 WP_001139189.1.79155 WP_001139189.1.79164 WP_001139189.1.79204 WP_001139189.1.79280 WP_001139189.1.79397 WP_001139189.1.79456 WP_001139189.1.79532 WP_001139189.1.79547 WP_001139189.1.79654 WP_001139189.1.7970 WP_001139189.1.79722 WP_001139189.1.79772 WP_001139189.1.79880 WP_001139189.1.79916 WP_001139189.1.80065 WP_001139189.1.80103 WP_001139189.1.80273 WP_001139189.1.80282 WP_001139189.1.80354 WP_001139189.1.80368 WP_001139189.1.80386 WP_001139189.1.80400 WP_001139189.1.80462 WP_001139189.1.8049 WP_001139189.1.80492 WP_001139189.1.80569 WP_001139189.1.80664 WP_001139189.1.80696 WP_001139189.1.80984 WP_001139189.1.81131 WP_001139189.1.81187 WP_001139189.1.81262 WP_001139189.1.81268 WP_001139189.1.81269 WP_001139189.1.81271 WP_001139189.1.8131 WP_001139189.1.81333 WP_001139189.1.81342 WP_001139189.1.81364 WP_001139189.1.81494 WP_001139189.1.81557 WP_001139189.1.81676 WP_001139189.1.81681 WP_001139189.1.8170 WP_001139189.1.81763 WP_001139189.1.81855 WP_001139189.1.81921 WP_001139189.1.81931 WP_001139189.1.81936 WP_001139189.1.81949 WP_001139189.1.82070 WP_001139189.1.82076 WP_001139189.1.82131 WP_001139189.1.82156 WP_001139189.1.8218 WP_001139189.1.82180 WP_001139189.1.82201 WP_001139189.1.82214 WP_001139189.1.82225 WP_001139189.1.8240 WP_001139189.1.82408 WP_001139189.1.82416 WP_001139189.1.8242 WP_001139189.1.82456 WP_001139189.1.82465 WP_001139189.1.82473 WP_001139189.1.82553 WP_001139189.1.82646 WP_001139189.1.82670 WP_001139189.1.82731 WP_001139189.1.82812 WP_001139189.1.82850 WP_001139189.1.82872 WP_001139189.1.8294 WP_001139189.1.82959 WP_001139189.1.83007 WP_001139189.1.8304 WP_001139189.1.83180 WP_001139189.1.83229 WP_001139189.1.83235 WP_001139189.1.83290 WP_001139189.1.83333 WP_001139189.1.83657 WP_001139189.1.83677 WP_001139189.1.8375 WP_001139189.1.83923 WP_001139189.1.83994 WP_001139189.1.84 WP_001139189.1.8406 WP_001139189.1.84076 WP_001139189.1.84110 WP_001139189.1.84127 WP_001139189.1.84150 WP_001139189.1.84230 WP_001139189.1.84252 WP_001139189.1.8431 WP_001139189.1.84345 WP_001139189.1.84369 WP_001139189.1.84401 WP_001139189.1.84435 WP_001139189.1.84567 WP_001139189.1.84631 WP_001139189.1.84727 WP_001139189.1.84744 WP_001139189.1.84773 WP_001139189.1.84945 WP_001139189.1.84967 WP_001139189.1.85004 WP_001139189.1.8502 WP_001139189.1.85039 WP_001139189.1.85153 WP_001139189.1.85273 WP_001139189.1.85338 WP_001139189.1.85339 WP_001139189.1.85511 WP_001139189.1.85512 WP_001139189.1.8557 WP_001139189.1.85606 WP_001139189.1.85635 WP_001139189.1.85646 WP_001139189.1.85665 WP_001139189.1.85669 WP_001139189.1.85688 WP_001139189.1.85703 WP_001139189.1.85728 WP_001139189.1.85746 WP_001139189.1.85811 WP_001139189.1.859 WP_001139189.1.85917 WP_001139189.1.8594 WP_001139189.1.85977 WP_001139189.1.860 WP_001139189.1.8605 WP_001139189.1.86084 WP_001139189.1.8610 WP_001139189.1.8614 WP_001139189.1.86156 WP_001139189.1.86323 WP_001139189.1.86342 WP_001139189.1.8640 WP_001139189.1.8642 WP_001139189.1.86426 WP_001139189.1.86489 WP_001139189.1.86530 WP_001139189.1.86663 WP_001139189.1.86770 WP_001139189.1.86794 WP_001139189.1.86800 WP_001139189.1.86811 WP_001139189.1.86815 WP_001139189.1.86945 WP_001139189.1.86989 WP_001139189.1.87023 WP_001139189.1.87034 WP_001139189.1.87041 WP_001139189.1.87136 WP_001139189.1.87155 WP_001139189.1.87258 WP_001139189.1.87293 WP_001139189.1.87420 WP_001139189.1.87528 WP_001139189.1.87560 WP_001139189.1.8760 WP_001139189.1.87600 WP_001139189.1.87609 WP_001139189.1.87612 WP_001139189.1.87615 WP_001139189.1.87653 WP_001139189.1.87659 WP_001139189.1.87698 WP_001139189.1.87706 WP_001139189.1.87739 WP_001139189.1.87741 WP_001139189.1.87742 WP_001139189.1.87852 WP_001139189.1.87949 WP_001139189.1.88025 WP_001139189.1.88026 WP_001139189.1.8805 WP_001139189.1.8806 WP_001139189.1.881 WP_001139189.1.88145 WP_001139189.1.88199 WP_001139189.1.88299 WP_001139189.1.88313 WP_001139189.1.88359 WP_001139189.1.88407 WP_001139189.1.88414 WP_001139189.1.88444 WP_001139189.1.88446 WP_001139189.1.88458 WP_001139189.1.88501 WP_001139189.1.88538 WP_001139189.1.88547 WP_001139189.1.886 WP_001139189.1.88647 WP_001139189.1.88648 WP_001139189.1.88692 WP_001139189.1.88707 WP_001139189.1.88727 WP_001139189.1.88772 WP_001139189.1.88850 WP_001139189.1.8889 WP_001139189.1.88894 WP_001139189.1.89182 WP_001139189.1.89298 WP_001139189.1.89308 WP_001139189.1.89314 WP_001139189.1.89328 WP_001139189.1.89332 WP_001139189.1.89343 WP_001139189.1.89395 WP_001139189.1.8940 WP_001139189.1.89449 WP_001139189.1.8947 WP_001139189.1.89503 WP_001139189.1.89591 WP_001139189.1.89612 WP_001139189.1.89668 WP_001139189.1.89706 WP_001139189.1.89713 WP_001139189.1.89733 WP_001139189.1.89796 WP_001139189.1.89804 WP_001139189.1.89845 WP_001139189.1.89888 WP_001139189.1.89911 WP_001139189.1.8995 WP_001139189.1.89952 WP_001139189.1.90007 WP_001139189.1.9011 WP_001139189.1.90196 WP_001139189.1.90240 WP_001139189.1.90274 WP_001139189.1.90280 WP_001139189.1.90330 WP_001139189.1.90338 WP_001139189.1.90365 WP_001139189.1.90428 WP_001139189.1.90489 WP_001139189.1.90513 WP_001139189.1.90582 WP_001139189.1.90713 WP_001139189.1.90794 WP_001139189.1.90796 WP_001139189.1.90811 WP_001139189.1.9091 WP_001139189.1.91067 WP_001139189.1.91164 WP_001139189.1.91205 WP_001139189.1.91239 WP_001139189.1.91291 WP_001139189.1.91313 WP_001139189.1.9135 WP_001139189.1.91506 WP_001139189.1.91557 WP_001139189.1.91597 WP_001139189.1.91715 WP_001139189.1.9187 WP_001139189.1.91870 WP_001139189.1.92018 WP_001139189.1.92087 WP_001139189.1.92098 WP_001139189.1.92156 WP_001139189.1.92172 WP_001139189.1.92240 WP_001139189.1.92243 WP_001139189.1.92327 WP_001139189.1.92470 WP_001139189.1.92477 WP_001139189.1.92545 WP_001139189.1.92570 WP_001139189.1.92588 WP_001139189.1.926 WP_001139189.1.92633 WP_001139189.1.92649 WP_001139189.1.92676 WP_001139189.1.92705 WP_001139189.1.9271 WP_001139189.1.92734 WP_001139189.1.92810 WP_001139189.1.92823 WP_001139189.1.92987 WP_001139189.1.93007 WP_001139189.1.93022 WP_001139189.1.93103 WP_001139189.1.93105 WP_001139189.1.93111 WP_001139189.1.93121 WP_001139189.1.93168 WP_001139189.1.93184 WP_001139189.1.93221 WP_001139189.1.93223 WP_001139189.1.93239 WP_001139189.1.93302 WP_001139189.1.9336 WP_001139189.1.93387 WP_001139189.1.93469 WP_001139189.1.93511 WP_001139189.1.93512 WP_001139189.1.93635 WP_001139189.1.93657 WP_001139189.1.9374 WP_001139189.1.9375 WP_001139189.1.93754 WP_001139189.1.93780 WP_001139189.1.93828 WP_001139189.1.93842 WP_001139189.1.93843 WP_001139189.1.93875 WP_001139189.1.93909 WP_001139189.1.93919 WP_001139189.1.93938 WP_001139189.1.93984 WP_001139189.1.9399 WP_001139189.1.94017 WP_001139189.1.94079 WP_001139189.1.94097 WP_001139189.1.94107 WP_001139189.1.94142 WP_001139189.1.94215 WP_001139189.1.94303 WP_001139189.1.94365 WP_001139189.1.94390 WP_001139189.1.94415 WP_001139189.1.94492 WP_001139189.1.94510 WP_001139189.1.94527 WP_001139189.1.94573 WP_001139189.1.94579 WP_001139189.1.94586 WP_001139189.1.94593 WP_001139189.1.94650 WP_001139189.1.94659 WP_001139189.1.94662 WP_001139189.1.94700 WP_001139189.1.94745 WP_001139189.1.94782 WP_001139189.1.94815 WP_001139189.1.94820 WP_001139189.1.94850 WP_001139189.1.94851 WP_001139189.1.94864 WP_001139189.1.94952 WP_001139189.1.95006 WP_001139189.1.95055 WP_001139189.1.95076 WP_001139189.1.95099 WP_001139189.1.95165 WP_001139189.1.95239 WP_001139189.1.95246 WP_001139189.1.9525 WP_001139189.1.95255 WP_001139189.1.95265 WP_001139189.1.95338 WP_001139189.1.95412 WP_001139189.1.95530 WP_001139189.1.95547 WP_001139189.1.95590 WP_001139189.1.95625 WP_001139189.1.95675 WP_001139189.1.95716 WP_001139189.1.95776 WP_001139189.1.95884 WP_001139189.1.95890 WP_001139189.1.95906 WP_001139189.1.96025 WP_001139189.1.96044 WP_001139189.1.96054 WP_001139189.1.96094 WP_001139189.1.96127 WP_001139189.1.96144 WP_001139189.1.96188 WP_001139189.1.96211 WP_001139189.1.96212 WP_001139189.1.96319 WP_001139189.1.9633 WP_001139189.1.96359 WP_001139189.1.96539 WP_001139189.1.96552 WP_001139189.1.96610 WP_001139189.1.96625 WP_001139189.1.96635 WP_001139189.1.9664 WP_001139189.1.96675 WP_001139189.1.9670 WP_001139189.1.96750 WP_001139189.1.96792 WP_001139189.1.96801 WP_001139189.1.96803 WP_001139189.1.96925 WP_001139189.1.96938 WP_001139189.1.96946 WP_001139189.1.96957 WP_001139189.1.96978 WP_001139189.1.97026 WP_001139189.1.97028 WP_001139189.1.97079 WP_001139189.1.97154 WP_001139189.1.97184 WP_001139189.1.97287 WP_001139189.1.97291 WP_001139189.1.97422 WP_001139189.1.97441 WP_001139189.1.97497 WP_001139189.1.97505 WP_001139189.1.97599 WP_001139189.1.97606 WP_001139189.1.97615 WP_001139189.1.97646 WP_001139189.1.97690 WP_001139189.1.97819 WP_001139189.1.97840 WP_001139189.1.97938 WP_001139189.1.97986 WP_001139189.1.98036 WP_001139189.1.98080 WP_001139189.1.98086 WP_001139189.1.98158 WP_001139189.1.98263 WP_001139189.1.98418 WP_001139189.1.98448 WP_001139189.1.98457 WP_001139189.1.9850 WP_001139189.1.98502 WP_001139189.1.98607 WP_001139189.1.98731 WP_001139189.1.98762 WP_001139189.1.9877 WP_001139189.1.98801 WP_001139189.1.98818 WP_001139189.1.99163 WP_001139189.1.99335 WP_001139189.1.99350 WP_001139189.1.99360 WP_001139189.1.99363 WP_001139189.1.99369 WP_001139189.1.99388 WP_001139189.1.99397 WP_001139189.1.99463 WP_001139189.1.99483 WP_001139189.1.99546 WP_001139189.1.99579 WP_001139189.1.99595 WP_001139189.1.99676 WP_001139189.1.99764 WP_001139189.1.99829 WP_001139189.1.99837 WP_001139189.1.99841 WP_001139189.1.9992 WP_001139189.1.99996 gi|378962663|ref|YP_005220149.1| gi|16763246|ref|NP_458863.1| gi|488656912|ref|YP_007928715.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]