SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|541470411|ref|NP_456840.3| from Salmonella enterica subsp. enterica serovar Typhi str. CT18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|541470411|ref|NP_456840.3|
Domain Number 1 Region: 10-382
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.03e-116
Family GABA-aminotransferase-like 0.00000000000284
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|541470411|ref|NP_456840.3|
Sequence length 385
Comment lipopolysaccharide biosynthesis protein [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
Sequence
MAEGKMMSDFLPFSRPAMGAEELAAVKTVLDSGWITTGPKNQELEAAFCRLTGNQYAVAV
SSATAGMHIALMALGIGEGDEVITPSMTWVSTLNMIVLLGATPVMVDVDRDTLMVTPEHI
EAAITPQTKAIIPVHYAGAPADLDAIYALGARYGIPVIEDAAHATGTSYKGRHIGARGTA
IFSFHAIKNITCAEGGIVVTDNPQFADKLRSLKFHGLGVDAWDRQSGGRAPQAEVLAPGY
KYNLPDFNAAIALAQLQKLDALNARRAAIAAQYHQAMADLPFQPLSLPPWEHIHAWHLFI
IRVDEARCGITRDALMASLKTKGIGTGLHFRAAHTQKYYRERFPTLTLPDTEWNSERICS
LPLFPDMTESDFDRVITALHQIAGQ
Download sequence
Identical sequences gi|541470411|ref|NP_456840.3| NP_456840.3.84458 WP_001764145.1.100008 WP_001764145.1.100036 WP_001764145.1.100079 WP_001764145.1.100196 WP_001764145.1.100284 WP_001764145.1.100313 WP_001764145.1.100314 WP_001764145.1.100321 WP_001764145.1.100354 WP_001764145.1.100421 WP_001764145.1.100446 WP_001764145.1.100450 WP_001764145.1.100592 WP_001764145.1.100610 WP_001764145.1.100732 WP_001764145.1.100733 WP_001764145.1.100739 WP_001764145.1.100764 WP_001764145.1.100799 WP_001764145.1.100941 WP_001764145.1.100953 WP_001764145.1.101011 WP_001764145.1.10108 WP_001764145.1.101226 WP_001764145.1.10124 WP_001764145.1.101271 WP_001764145.1.101312 WP_001764145.1.101322 WP_001764145.1.101374 WP_001764145.1.101616 WP_001764145.1.101890 WP_001764145.1.101941 WP_001764145.1.102050 WP_001764145.1.102087 WP_001764145.1.10338 WP_001764145.1.1038 WP_001764145.1.104 WP_001764145.1.10401 WP_001764145.1.10428 WP_001764145.1.10459 WP_001764145.1.10475 WP_001764145.1.10511 WP_001764145.1.10514 WP_001764145.1.10530 WP_001764145.1.10532 WP_001764145.1.10547 WP_001764145.1.10595 WP_001764145.1.10642 WP_001764145.1.10654 WP_001764145.1.10677 WP_001764145.1.10857 WP_001764145.1.10873 WP_001764145.1.10926 WP_001764145.1.10936 WP_001764145.1.11012 WP_001764145.1.11055 WP_001764145.1.11126 WP_001764145.1.11142 WP_001764145.1.11239 WP_001764145.1.11253 WP_001764145.1.11314 WP_001764145.1.11385 WP_001764145.1.1142 WP_001764145.1.11426 WP_001764145.1.11429 WP_001764145.1.11557 WP_001764145.1.11567 WP_001764145.1.11638 WP_001764145.1.11883 WP_001764145.1.11908 WP_001764145.1.11914 WP_001764145.1.12040 WP_001764145.1.12061 WP_001764145.1.1207 WP_001764145.1.12141 WP_001764145.1.12172 WP_001764145.1.12192 WP_001764145.1.1224 WP_001764145.1.12364 WP_001764145.1.12398 WP_001764145.1.12441 WP_001764145.1.12581 WP_001764145.1.12620 WP_001764145.1.12648 WP_001764145.1.12683 WP_001764145.1.12726 WP_001764145.1.12727 WP_001764145.1.12741 WP_001764145.1.12834 WP_001764145.1.13108 WP_001764145.1.13161 WP_001764145.1.1321 WP_001764145.1.13268 WP_001764145.1.13291 WP_001764145.1.133 WP_001764145.1.13314 WP_001764145.1.13338 WP_001764145.1.13342 WP_001764145.1.13352 WP_001764145.1.13406 WP_001764145.1.13440 WP_001764145.1.13443 WP_001764145.1.13476 WP_001764145.1.13599 WP_001764145.1.13686 WP_001764145.1.1372 WP_001764145.1.13732 WP_001764145.1.1382 WP_001764145.1.1397 WP_001764145.1.13972 WP_001764145.1.140 WP_001764145.1.1401 WP_001764145.1.1408 WP_001764145.1.14089 WP_001764145.1.14099 WP_001764145.1.14120 WP_001764145.1.14123 WP_001764145.1.14150 WP_001764145.1.14191 WP_001764145.1.14197 WP_001764145.1.14280 WP_001764145.1.14333 WP_001764145.1.14399 WP_001764145.1.14444 WP_001764145.1.14467 WP_001764145.1.14474 WP_001764145.1.14500 WP_001764145.1.14526 WP_001764145.1.14550 WP_001764145.1.14575 WP_001764145.1.14701 WP_001764145.1.14703 WP_001764145.1.14719 WP_001764145.1.1473 WP_001764145.1.14765 WP_001764145.1.14810 WP_001764145.1.14877 WP_001764145.1.14894 WP_001764145.1.14930 WP_001764145.1.14947 WP_001764145.1.14948 WP_001764145.1.15184 WP_001764145.1.15244 WP_001764145.1.15265 WP_001764145.1.15362 WP_001764145.1.15415 WP_001764145.1.15423 WP_001764145.1.15433 WP_001764145.1.15439 WP_001764145.1.15487 WP_001764145.1.15535 WP_001764145.1.15581 WP_001764145.1.15597 WP_001764145.1.15710 WP_001764145.1.15717 WP_001764145.1.15905 WP_001764145.1.15912 WP_001764145.1.15970 WP_001764145.1.16046 WP_001764145.1.16051 WP_001764145.1.16058 WP_001764145.1.16150 WP_001764145.1.16155 WP_001764145.1.1626 WP_001764145.1.16264 WP_001764145.1.16344 WP_001764145.1.16452 WP_001764145.1.16461 WP_001764145.1.16462 WP_001764145.1.16465 WP_001764145.1.16522 WP_001764145.1.16588 WP_001764145.1.16658 WP_001764145.1.16666 WP_001764145.1.16673 WP_001764145.1.1674 WP_001764145.1.16767 WP_001764145.1.16781 WP_001764145.1.16879 WP_001764145.1.16893 WP_001764145.1.16905 WP_001764145.1.16948 WP_001764145.1.17049 WP_001764145.1.17058 WP_001764145.1.17078 WP_001764145.1.17202 WP_001764145.1.17219 WP_001764145.1.1722 WP_001764145.1.17302 WP_001764145.1.17308 WP_001764145.1.17368 WP_001764145.1.17405 WP_001764145.1.17406 WP_001764145.1.17513 WP_001764145.1.17543 WP_001764145.1.17563 WP_001764145.1.17578 WP_001764145.1.17622 WP_001764145.1.17659 WP_001764145.1.17667 WP_001764145.1.17686 WP_001764145.1.17741 WP_001764145.1.17840 WP_001764145.1.17956 WP_001764145.1.18005 WP_001764145.1.1801 WP_001764145.1.18021 WP_001764145.1.18099 WP_001764145.1.18124 WP_001764145.1.18144 WP_001764145.1.18173 WP_001764145.1.18270 WP_001764145.1.18280 WP_001764145.1.18328 WP_001764145.1.18358 WP_001764145.1.18370 WP_001764145.1.18406 WP_001764145.1.18474 WP_001764145.1.18513 WP_001764145.1.18610 WP_001764145.1.18678 WP_001764145.1.18722 WP_001764145.1.18766 WP_001764145.1.1880 WP_001764145.1.1885 WP_001764145.1.18860 WP_001764145.1.18922 WP_001764145.1.18959 WP_001764145.1.19001 WP_001764145.1.19006 WP_001764145.1.19044 WP_001764145.1.19084 WP_001764145.1.19187 WP_001764145.1.19228 WP_001764145.1.19288 WP_001764145.1.19300 WP_001764145.1.19422 WP_001764145.1.19454 WP_001764145.1.19456 WP_001764145.1.19496 WP_001764145.1.19535 WP_001764145.1.19538 WP_001764145.1.19589 WP_001764145.1.19663 WP_001764145.1.19686 WP_001764145.1.19731 WP_001764145.1.19794 WP_001764145.1.1992 WP_001764145.1.19999 WP_001764145.1.20254 WP_001764145.1.20255 WP_001764145.1.20296 WP_001764145.1.20339 WP_001764145.1.20419 WP_001764145.1.20465 WP_001764145.1.20492 WP_001764145.1.2053 WP_001764145.1.20635 WP_001764145.1.20718 WP_001764145.1.2073 WP_001764145.1.20740 WP_001764145.1.20828 WP_001764145.1.2087 WP_001764145.1.20883 WP_001764145.1.20947 WP_001764145.1.20953 WP_001764145.1.21010 WP_001764145.1.2106 WP_001764145.1.21062 WP_001764145.1.21144 WP_001764145.1.21162 WP_001764145.1.21184 WP_001764145.1.21185 WP_001764145.1.21366 WP_001764145.1.21492 WP_001764145.1.2166 WP_001764145.1.21674 WP_001764145.1.21946 WP_001764145.1.21966 WP_001764145.1.22064 WP_001764145.1.22118 WP_001764145.1.22126 WP_001764145.1.2216 WP_001764145.1.22208 WP_001764145.1.2227 WP_001764145.1.22373 WP_001764145.1.22476 WP_001764145.1.22614 WP_001764145.1.22652 WP_001764145.1.22683 WP_001764145.1.2284 WP_001764145.1.22895 WP_001764145.1.22926 WP_001764145.1.22943 WP_001764145.1.22967 WP_001764145.1.23040 WP_001764145.1.23058 WP_001764145.1.23218 WP_001764145.1.2331 WP_001764145.1.2332 WP_001764145.1.23340 WP_001764145.1.2336 WP_001764145.1.23365 WP_001764145.1.23412 WP_001764145.1.23426 WP_001764145.1.23492 WP_001764145.1.23515 WP_001764145.1.23548 WP_001764145.1.23571 WP_001764145.1.23604 WP_001764145.1.23728 WP_001764145.1.2375 WP_001764145.1.23783 WP_001764145.1.23786 WP_001764145.1.23787 WP_001764145.1.23801 WP_001764145.1.24028 WP_001764145.1.24061 WP_001764145.1.24083 WP_001764145.1.24117 WP_001764145.1.24125 WP_001764145.1.24138 WP_001764145.1.24153 WP_001764145.1.24291 WP_001764145.1.24322 WP_001764145.1.24355 WP_001764145.1.24375 WP_001764145.1.24400 WP_001764145.1.24420 WP_001764145.1.24619 WP_001764145.1.24643 WP_001764145.1.24688 WP_001764145.1.24716 WP_001764145.1.2481 WP_001764145.1.24832 WP_001764145.1.24964 WP_001764145.1.25017 WP_001764145.1.25032 WP_001764145.1.25041 WP_001764145.1.25053 WP_001764145.1.25140 WP_001764145.1.25185 WP_001764145.1.25196 WP_001764145.1.25210 WP_001764145.1.25219 WP_001764145.1.25304 WP_001764145.1.25374 WP_001764145.1.25475 WP_001764145.1.25490 WP_001764145.1.25508 WP_001764145.1.25512 WP_001764145.1.25603 WP_001764145.1.2562 WP_001764145.1.25666 WP_001764145.1.25807 WP_001764145.1.25821 WP_001764145.1.25833 WP_001764145.1.25835 WP_001764145.1.25882 WP_001764145.1.25911 WP_001764145.1.25962 WP_001764145.1.25963 WP_001764145.1.26001 WP_001764145.1.26027 WP_001764145.1.26107 WP_001764145.1.2615 WP_001764145.1.26217 WP_001764145.1.26230 WP_001764145.1.26232 WP_001764145.1.26272 WP_001764145.1.26286 WP_001764145.1.26288 WP_001764145.1.26394 WP_001764145.1.26491 WP_001764145.1.2654 WP_001764145.1.26554 WP_001764145.1.26636 WP_001764145.1.26689 WP_001764145.1.2679 WP_001764145.1.26908 WP_001764145.1.2692 WP_001764145.1.26928 WP_001764145.1.270 WP_001764145.1.27008 WP_001764145.1.27027 WP_001764145.1.27070 WP_001764145.1.27077 WP_001764145.1.27086 WP_001764145.1.27087 WP_001764145.1.27111 WP_001764145.1.27115 WP_001764145.1.2713 WP_001764145.1.2717 WP_001764145.1.27228 WP_001764145.1.27282 WP_001764145.1.27285 WP_001764145.1.27309 WP_001764145.1.27329 WP_001764145.1.27361 WP_001764145.1.27565 WP_001764145.1.27595 WP_001764145.1.27598 WP_001764145.1.27706 WP_001764145.1.27775 WP_001764145.1.27785 WP_001764145.1.27900 WP_001764145.1.27928 WP_001764145.1.27945 WP_001764145.1.28004 WP_001764145.1.2809 WP_001764145.1.28155 WP_001764145.1.28198 WP_001764145.1.2822 WP_001764145.1.28229 WP_001764145.1.28384 WP_001764145.1.28386 WP_001764145.1.28395 WP_001764145.1.284 WP_001764145.1.2845 WP_001764145.1.28479 WP_001764145.1.28627 WP_001764145.1.28692 WP_001764145.1.2873 WP_001764145.1.28962 WP_001764145.1.29023 WP_001764145.1.29042 WP_001764145.1.2905 WP_001764145.1.2907 WP_001764145.1.29081 WP_001764145.1.29089 WP_001764145.1.29153 WP_001764145.1.29203 WP_001764145.1.29237 WP_001764145.1.29248 WP_001764145.1.29288 WP_001764145.1.29389 WP_001764145.1.29439 WP_001764145.1.2946 WP_001764145.1.29462 WP_001764145.1.29563 WP_001764145.1.29727 WP_001764145.1.29743 WP_001764145.1.29782 WP_001764145.1.29833 WP_001764145.1.29851 WP_001764145.1.29865 WP_001764145.1.29886 WP_001764145.1.29919 WP_001764145.1.2994 WP_001764145.1.29964 WP_001764145.1.29983 WP_001764145.1.30009 WP_001764145.1.30013 WP_001764145.1.3002 WP_001764145.1.30034 WP_001764145.1.30049 WP_001764145.1.30058 WP_001764145.1.30172 WP_001764145.1.30185 WP_001764145.1.30354 WP_001764145.1.30357 WP_001764145.1.30362 WP_001764145.1.3042 WP_001764145.1.30421 WP_001764145.1.30440 WP_001764145.1.30448 WP_001764145.1.30489 WP_001764145.1.30517 WP_001764145.1.30542 WP_001764145.1.30544 WP_001764145.1.30556 WP_001764145.1.30572 WP_001764145.1.30585 WP_001764145.1.30618 WP_001764145.1.30664 WP_001764145.1.30688 WP_001764145.1.30806 WP_001764145.1.30967 WP_001764145.1.31046 WP_001764145.1.31066 WP_001764145.1.31078 WP_001764145.1.31139 WP_001764145.1.31145 WP_001764145.1.31182 WP_001764145.1.31205 WP_001764145.1.3121 WP_001764145.1.31223 WP_001764145.1.31303 WP_001764145.1.3131 WP_001764145.1.31352 WP_001764145.1.31389 WP_001764145.1.31413 WP_001764145.1.31446 WP_001764145.1.31533 WP_001764145.1.31799 WP_001764145.1.31836 WP_001764145.1.31951 WP_001764145.1.32041 WP_001764145.1.32042 WP_001764145.1.3207 WP_001764145.1.32189 WP_001764145.1.32202 WP_001764145.1.32263 WP_001764145.1.32293 WP_001764145.1.32299 WP_001764145.1.32422 WP_001764145.1.32425 WP_001764145.1.32458 WP_001764145.1.32460 WP_001764145.1.32529 WP_001764145.1.32563 WP_001764145.1.32578 WP_001764145.1.32617 WP_001764145.1.3270 WP_001764145.1.32725 WP_001764145.1.32838 WP_001764145.1.32848 WP_001764145.1.32868 WP_001764145.1.3290 WP_001764145.1.32940 WP_001764145.1.32941 WP_001764145.1.3296 WP_001764145.1.32966 WP_001764145.1.32985 WP_001764145.1.33037 WP_001764145.1.3305 WP_001764145.1.33051 WP_001764145.1.33065 WP_001764145.1.33122 WP_001764145.1.3315 WP_001764145.1.33208 WP_001764145.1.33214 WP_001764145.1.33247 WP_001764145.1.33280 WP_001764145.1.33283 WP_001764145.1.33313 WP_001764145.1.33339 WP_001764145.1.33382 WP_001764145.1.33490 WP_001764145.1.33501 WP_001764145.1.33529 WP_001764145.1.33689 WP_001764145.1.3370 WP_001764145.1.33730 WP_001764145.1.33741 WP_001764145.1.33840 WP_001764145.1.3392 WP_001764145.1.33926 WP_001764145.1.33957 WP_001764145.1.33969 WP_001764145.1.34001 WP_001764145.1.34059 WP_001764145.1.34118 WP_001764145.1.34211 WP_001764145.1.34214 WP_001764145.1.34234 WP_001764145.1.34284 WP_001764145.1.34376 WP_001764145.1.34382 WP_001764145.1.34484 WP_001764145.1.34517 WP_001764145.1.34530 WP_001764145.1.34665 WP_001764145.1.34694 WP_001764145.1.34751 WP_001764145.1.34808 WP_001764145.1.34824 WP_001764145.1.34834 WP_001764145.1.34932 WP_001764145.1.34962 WP_001764145.1.35001 WP_001764145.1.35040 WP_001764145.1.35074 WP_001764145.1.35175 WP_001764145.1.35240 WP_001764145.1.35274 WP_001764145.1.35532 WP_001764145.1.35560 WP_001764145.1.3557 WP_001764145.1.35628 WP_001764145.1.3570 WP_001764145.1.35712 WP_001764145.1.35713 WP_001764145.1.35736 WP_001764145.1.35791 WP_001764145.1.35795 WP_001764145.1.35870 WP_001764145.1.35916 WP_001764145.1.35938 WP_001764145.1.35966 WP_001764145.1.36000 WP_001764145.1.36034 WP_001764145.1.36036 WP_001764145.1.36069 WP_001764145.1.36291 WP_001764145.1.36298 WP_001764145.1.36308 WP_001764145.1.36323 WP_001764145.1.36343 WP_001764145.1.36460 WP_001764145.1.3649 WP_001764145.1.36495 WP_001764145.1.36526 WP_001764145.1.36567 WP_001764145.1.36579 WP_001764145.1.36617 WP_001764145.1.36618 WP_001764145.1.36643 WP_001764145.1.36663 WP_001764145.1.36701 WP_001764145.1.36725 WP_001764145.1.36779 WP_001764145.1.36798 WP_001764145.1.36802 WP_001764145.1.36821 WP_001764145.1.36853 WP_001764145.1.36950 WP_001764145.1.37014 WP_001764145.1.37133 WP_001764145.1.37176 WP_001764145.1.37199 WP_001764145.1.37200 WP_001764145.1.37258 WP_001764145.1.37303 WP_001764145.1.37513 WP_001764145.1.37584 WP_001764145.1.37590 WP_001764145.1.37593 WP_001764145.1.37600 WP_001764145.1.37613 WP_001764145.1.37659 WP_001764145.1.37662 WP_001764145.1.37675 WP_001764145.1.37691 WP_001764145.1.37761 WP_001764145.1.37775 WP_001764145.1.37777 WP_001764145.1.378 WP_001764145.1.379 WP_001764145.1.37911 WP_001764145.1.37941 WP_001764145.1.37985 WP_001764145.1.38061 WP_001764145.1.38064 WP_001764145.1.38108 WP_001764145.1.3816 WP_001764145.1.38207 WP_001764145.1.38261 WP_001764145.1.38266 WP_001764145.1.38310 WP_001764145.1.3834 WP_001764145.1.38351 WP_001764145.1.3838 WP_001764145.1.38381 WP_001764145.1.38440 WP_001764145.1.38486 WP_001764145.1.38515 WP_001764145.1.38595 WP_001764145.1.3860 WP_001764145.1.38642 WP_001764145.1.38734 WP_001764145.1.38877 WP_001764145.1.38983 WP_001764145.1.38996 WP_001764145.1.39056 WP_001764145.1.3907 WP_001764145.1.39105 WP_001764145.1.3914 WP_001764145.1.39147 WP_001764145.1.39161 WP_001764145.1.39210 WP_001764145.1.39235 WP_001764145.1.3931 WP_001764145.1.39435 WP_001764145.1.39502 WP_001764145.1.39530 WP_001764145.1.39619 WP_001764145.1.39620 WP_001764145.1.39624 WP_001764145.1.39659 WP_001764145.1.39667 WP_001764145.1.39775 WP_001764145.1.39879 WP_001764145.1.39890 WP_001764145.1.39941 WP_001764145.1.39945 WP_001764145.1.39947 WP_001764145.1.40095 WP_001764145.1.40097 WP_001764145.1.401 WP_001764145.1.40160 WP_001764145.1.40167 WP_001764145.1.40279 WP_001764145.1.40361 WP_001764145.1.4042 WP_001764145.1.40467 WP_001764145.1.40496 WP_001764145.1.40517 WP_001764145.1.40698 WP_001764145.1.40750 WP_001764145.1.40763 WP_001764145.1.40854 WP_001764145.1.4089 WP_001764145.1.40924 WP_001764145.1.40932 WP_001764145.1.40946 WP_001764145.1.41004 WP_001764145.1.4106 WP_001764145.1.41070 WP_001764145.1.41074 WP_001764145.1.41075 WP_001764145.1.41097 WP_001764145.1.41132 WP_001764145.1.41176 WP_001764145.1.41251 WP_001764145.1.41258 WP_001764145.1.41305 WP_001764145.1.41321 WP_001764145.1.41333 WP_001764145.1.41335 WP_001764145.1.4136 WP_001764145.1.41415 WP_001764145.1.41459 WP_001764145.1.41498 WP_001764145.1.41519 WP_001764145.1.41524 WP_001764145.1.41631 WP_001764145.1.41658 WP_001764145.1.41659 WP_001764145.1.41716 WP_001764145.1.41746 WP_001764145.1.41824 WP_001764145.1.41825 WP_001764145.1.41836 WP_001764145.1.41894 WP_001764145.1.41919 WP_001764145.1.41929 WP_001764145.1.4194 WP_001764145.1.42069 WP_001764145.1.42081 WP_001764145.1.42090 WP_001764145.1.42111 WP_001764145.1.42187 WP_001764145.1.42200 WP_001764145.1.42219 WP_001764145.1.42257 WP_001764145.1.42261 WP_001764145.1.42349 WP_001764145.1.42364 WP_001764145.1.42371 WP_001764145.1.42379 WP_001764145.1.42391 WP_001764145.1.42399 WP_001764145.1.42539 WP_001764145.1.42603 WP_001764145.1.42650 WP_001764145.1.4267 WP_001764145.1.42701 WP_001764145.1.42805 WP_001764145.1.42815 WP_001764145.1.42859 WP_001764145.1.4298 WP_001764145.1.43008 WP_001764145.1.43016 WP_001764145.1.43019 WP_001764145.1.43065 WP_001764145.1.43068 WP_001764145.1.43069 WP_001764145.1.43128 WP_001764145.1.43141 WP_001764145.1.43157 WP_001764145.1.43161 WP_001764145.1.43190 WP_001764145.1.43198 WP_001764145.1.4326 WP_001764145.1.43290 WP_001764145.1.43292 WP_001764145.1.43307 WP_001764145.1.43513 WP_001764145.1.43633 WP_001764145.1.43637 WP_001764145.1.43651 WP_001764145.1.43722 WP_001764145.1.43801 WP_001764145.1.43812 WP_001764145.1.43878 WP_001764145.1.43888 WP_001764145.1.43919 WP_001764145.1.43974 WP_001764145.1.44049 WP_001764145.1.44101 WP_001764145.1.44160 WP_001764145.1.44180 WP_001764145.1.44196 WP_001764145.1.44248 WP_001764145.1.44262 WP_001764145.1.44268 WP_001764145.1.4427 WP_001764145.1.44296 WP_001764145.1.44343 WP_001764145.1.44351 WP_001764145.1.44360 WP_001764145.1.44416 WP_001764145.1.44431 WP_001764145.1.44437 WP_001764145.1.44546 WP_001764145.1.4468 WP_001764145.1.44762 WP_001764145.1.44815 WP_001764145.1.44828 WP_001764145.1.44879 WP_001764145.1.44917 WP_001764145.1.4501 WP_001764145.1.45072 WP_001764145.1.45093 WP_001764145.1.45136 WP_001764145.1.45241 WP_001764145.1.45435 WP_001764145.1.45523 WP_001764145.1.45596 WP_001764145.1.45648 WP_001764145.1.45829 WP_001764145.1.45871 WP_001764145.1.46030 WP_001764145.1.46077 WP_001764145.1.46169 WP_001764145.1.46225 WP_001764145.1.46241 WP_001764145.1.46307 WP_001764145.1.46355 WP_001764145.1.464 WP_001764145.1.46454 WP_001764145.1.46461 WP_001764145.1.46504 WP_001764145.1.46505 WP_001764145.1.46551 WP_001764145.1.46559 WP_001764145.1.46701 WP_001764145.1.46781 WP_001764145.1.46816 WP_001764145.1.46842 WP_001764145.1.4690 WP_001764145.1.46920 WP_001764145.1.46945 WP_001764145.1.47036 WP_001764145.1.47037 WP_001764145.1.47042 WP_001764145.1.47059 WP_001764145.1.47085 WP_001764145.1.47123 WP_001764145.1.47215 WP_001764145.1.47245 WP_001764145.1.47523 WP_001764145.1.47531 WP_001764145.1.47532 WP_001764145.1.47605 WP_001764145.1.47630 WP_001764145.1.4774 WP_001764145.1.47756 WP_001764145.1.4781 WP_001764145.1.47886 WP_001764145.1.47898 WP_001764145.1.48019 WP_001764145.1.48100 WP_001764145.1.48114 WP_001764145.1.48139 WP_001764145.1.48190 WP_001764145.1.48292 WP_001764145.1.48324 WP_001764145.1.48426 WP_001764145.1.48430 WP_001764145.1.48436 WP_001764145.1.48586 WP_001764145.1.4859 WP_001764145.1.48591 WP_001764145.1.48610 WP_001764145.1.48631 WP_001764145.1.48663 WP_001764145.1.48690 WP_001764145.1.48734 WP_001764145.1.48756 WP_001764145.1.48778 WP_001764145.1.48955 WP_001764145.1.48963 WP_001764145.1.48973 WP_001764145.1.49004 WP_001764145.1.49106 WP_001764145.1.49117 WP_001764145.1.49121 WP_001764145.1.4914 WP_001764145.1.49140 WP_001764145.1.49153 WP_001764145.1.49166 WP_001764145.1.49355 WP_001764145.1.49429 WP_001764145.1.49434 WP_001764145.1.49450 WP_001764145.1.495 WP_001764145.1.49545 WP_001764145.1.49703 WP_001764145.1.49769 WP_001764145.1.49846 WP_001764145.1.4991 WP_001764145.1.49947 WP_001764145.1.49959 WP_001764145.1.49997 WP_001764145.1.50014 WP_001764145.1.50030 WP_001764145.1.50043 WP_001764145.1.50103 WP_001764145.1.50158 WP_001764145.1.50247 WP_001764145.1.50308 WP_001764145.1.50309 WP_001764145.1.50387 WP_001764145.1.50406 WP_001764145.1.50468 WP_001764145.1.5051 WP_001764145.1.50566 WP_001764145.1.50570 WP_001764145.1.50626 WP_001764145.1.50726 WP_001764145.1.50771 WP_001764145.1.50875 WP_001764145.1.50885 WP_001764145.1.509 WP_001764145.1.50929 WP_001764145.1.50970 WP_001764145.1.51040 WP_001764145.1.51048 WP_001764145.1.51100 WP_001764145.1.51134 WP_001764145.1.51227 WP_001764145.1.5127 WP_001764145.1.51305 WP_001764145.1.51315 WP_001764145.1.5136 WP_001764145.1.51474 WP_001764145.1.51519 WP_001764145.1.51598 WP_001764145.1.51644 WP_001764145.1.51724 WP_001764145.1.51734 WP_001764145.1.51838 WP_001764145.1.51863 WP_001764145.1.51935 WP_001764145.1.52057 WP_001764145.1.52114 WP_001764145.1.52129 WP_001764145.1.52191 WP_001764145.1.52202 WP_001764145.1.52209 WP_001764145.1.52339 WP_001764145.1.52469 WP_001764145.1.52571 WP_001764145.1.526 WP_001764145.1.52647 WP_001764145.1.52742 WP_001764145.1.52773 WP_001764145.1.52795 WP_001764145.1.52807 WP_001764145.1.52887 WP_001764145.1.53092 WP_001764145.1.53141 WP_001764145.1.53151 WP_001764145.1.53154 WP_001764145.1.53159 WP_001764145.1.53210 WP_001764145.1.53233 WP_001764145.1.53307 WP_001764145.1.53321 WP_001764145.1.53368 WP_001764145.1.53375 WP_001764145.1.53450 WP_001764145.1.5349 WP_001764145.1.53540 WP_001764145.1.53555 WP_001764145.1.53559 WP_001764145.1.5356 WP_001764145.1.53571 WP_001764145.1.5358 WP_001764145.1.53692 WP_001764145.1.53723 WP_001764145.1.5374 WP_001764145.1.53750 WP_001764145.1.53800 WP_001764145.1.53815 WP_001764145.1.53839 WP_001764145.1.53892 WP_001764145.1.53898 WP_001764145.1.53902 WP_001764145.1.53958 WP_001764145.1.53981 WP_001764145.1.53984 WP_001764145.1.54132 WP_001764145.1.54170 WP_001764145.1.54175 WP_001764145.1.54203 WP_001764145.1.54259 WP_001764145.1.5430 WP_001764145.1.54371 WP_001764145.1.54431 WP_001764145.1.54442 WP_001764145.1.54482 WP_001764145.1.54589 WP_001764145.1.54667 WP_001764145.1.54678 WP_001764145.1.54681 WP_001764145.1.54748 WP_001764145.1.5481 WP_001764145.1.54865 WP_001764145.1.54935 WP_001764145.1.54979 WP_001764145.1.55010 WP_001764145.1.55034 WP_001764145.1.55163 WP_001764145.1.55165 WP_001764145.1.55215 WP_001764145.1.55290 WP_001764145.1.55310 WP_001764145.1.55317 WP_001764145.1.55379 WP_001764145.1.5539 WP_001764145.1.55468 WP_001764145.1.55506 WP_001764145.1.55604 WP_001764145.1.55639 WP_001764145.1.55699 WP_001764145.1.55725 WP_001764145.1.55780 WP_001764145.1.55967 WP_001764145.1.56172 WP_001764145.1.5621 WP_001764145.1.56226 WP_001764145.1.56311 WP_001764145.1.56419 WP_001764145.1.56423 WP_001764145.1.56514 WP_001764145.1.56535 WP_001764145.1.56585 WP_001764145.1.56640 WP_001764145.1.56724 WP_001764145.1.56825 WP_001764145.1.56887 WP_001764145.1.56889 WP_001764145.1.56981 WP_001764145.1.57101 WP_001764145.1.57137 WP_001764145.1.57147 WP_001764145.1.57179 WP_001764145.1.57186 WP_001764145.1.57342 WP_001764145.1.57684 WP_001764145.1.57699 WP_001764145.1.57785 WP_001764145.1.57800 WP_001764145.1.57873 WP_001764145.1.57965 WP_001764145.1.57972 WP_001764145.1.58008 WP_001764145.1.58044 WP_001764145.1.58081 WP_001764145.1.5809 WP_001764145.1.58132 WP_001764145.1.58173 WP_001764145.1.58191 WP_001764145.1.58194 WP_001764145.1.58252 WP_001764145.1.58261 WP_001764145.1.58274 WP_001764145.1.58282 WP_001764145.1.58324 WP_001764145.1.58326 WP_001764145.1.5836 WP_001764145.1.58485 WP_001764145.1.58537 WP_001764145.1.58568 WP_001764145.1.58583 WP_001764145.1.58652 WP_001764145.1.58663 WP_001764145.1.58724 WP_001764145.1.5875 WP_001764145.1.58796 WP_001764145.1.58807 WP_001764145.1.58847 WP_001764145.1.58883 WP_001764145.1.58898 WP_001764145.1.58949 WP_001764145.1.58963 WP_001764145.1.58970 WP_001764145.1.58974 WP_001764145.1.59020 WP_001764145.1.59043 WP_001764145.1.59056 WP_001764145.1.59061 WP_001764145.1.59064 WP_001764145.1.59282 WP_001764145.1.59299 WP_001764145.1.59313 WP_001764145.1.5949 WP_001764145.1.59501 WP_001764145.1.59510 WP_001764145.1.5969 WP_001764145.1.59751 WP_001764145.1.59827 WP_001764145.1.59829 WP_001764145.1.59847 WP_001764145.1.59863 WP_001764145.1.59969 WP_001764145.1.59994 WP_001764145.1.60045 WP_001764145.1.60076 WP_001764145.1.60114 WP_001764145.1.60154 WP_001764145.1.60168 WP_001764145.1.60192 WP_001764145.1.60199 WP_001764145.1.60212 WP_001764145.1.60253 WP_001764145.1.60322 WP_001764145.1.60324 WP_001764145.1.60356 WP_001764145.1.6038 WP_001764145.1.60380 WP_001764145.1.6041 WP_001764145.1.60424 WP_001764145.1.60481 WP_001764145.1.605 WP_001764145.1.6058 WP_001764145.1.60584 WP_001764145.1.6060 WP_001764145.1.60676 WP_001764145.1.60708 WP_001764145.1.60725 WP_001764145.1.60783 WP_001764145.1.60792 WP_001764145.1.60807 WP_001764145.1.60882 WP_001764145.1.60889 WP_001764145.1.60950 WP_001764145.1.6104 WP_001764145.1.61044 WP_001764145.1.61076 WP_001764145.1.61123 WP_001764145.1.61147 WP_001764145.1.61168 WP_001764145.1.61210 WP_001764145.1.61357 WP_001764145.1.61539 WP_001764145.1.61542 WP_001764145.1.61553 WP_001764145.1.61649 WP_001764145.1.61652 WP_001764145.1.61697 WP_001764145.1.61809 WP_001764145.1.61877 WP_001764145.1.61920 WP_001764145.1.62124 WP_001764145.1.62199 WP_001764145.1.62223 WP_001764145.1.62302 WP_001764145.1.62314 WP_001764145.1.62323 WP_001764145.1.62333 WP_001764145.1.62338 WP_001764145.1.62380 WP_001764145.1.62411 WP_001764145.1.62436 WP_001764145.1.62475 WP_001764145.1.62536 WP_001764145.1.62640 WP_001764145.1.62686 WP_001764145.1.62751 WP_001764145.1.62825 WP_001764145.1.62913 WP_001764145.1.62932 WP_001764145.1.62960 WP_001764145.1.63016 WP_001764145.1.63025 WP_001764145.1.63069 WP_001764145.1.63087 WP_001764145.1.63169 WP_001764145.1.63297 WP_001764145.1.63448 WP_001764145.1.63514 WP_001764145.1.63583 WP_001764145.1.63592 WP_001764145.1.63663 WP_001764145.1.63736 WP_001764145.1.63816 WP_001764145.1.63876 WP_001764145.1.6389 WP_001764145.1.63901 WP_001764145.1.63955 WP_001764145.1.63963 WP_001764145.1.64032 WP_001764145.1.64087 WP_001764145.1.6415 WP_001764145.1.64293 WP_001764145.1.64332 WP_001764145.1.64376 WP_001764145.1.644 WP_001764145.1.64471 WP_001764145.1.64501 WP_001764145.1.64538 WP_001764145.1.64632 WP_001764145.1.64648 WP_001764145.1.64654 WP_001764145.1.64662 WP_001764145.1.64663 WP_001764145.1.64709 WP_001764145.1.64710 WP_001764145.1.64744 WP_001764145.1.64763 WP_001764145.1.64817 WP_001764145.1.64847 WP_001764145.1.6487 WP_001764145.1.64891 WP_001764145.1.64974 WP_001764145.1.65054 WP_001764145.1.65075 WP_001764145.1.6514 WP_001764145.1.65172 WP_001764145.1.65191 WP_001764145.1.65200 WP_001764145.1.65211 WP_001764145.1.65218 WP_001764145.1.65226 WP_001764145.1.65249 WP_001764145.1.65266 WP_001764145.1.65395 WP_001764145.1.65459 WP_001764145.1.65463 WP_001764145.1.65487 WP_001764145.1.6549 WP_001764145.1.65499 WP_001764145.1.6554 WP_001764145.1.65650 WP_001764145.1.65697 WP_001764145.1.65699 WP_001764145.1.65737 WP_001764145.1.65755 WP_001764145.1.65812 WP_001764145.1.65846 WP_001764145.1.65863 WP_001764145.1.65985 WP_001764145.1.66021 WP_001764145.1.66031 WP_001764145.1.66052 WP_001764145.1.66064 WP_001764145.1.66109 WP_001764145.1.66145 WP_001764145.1.66183 WP_001764145.1.6620 WP_001764145.1.66216 WP_001764145.1.66234 WP_001764145.1.66273 WP_001764145.1.66324 WP_001764145.1.6634 WP_001764145.1.66361 WP_001764145.1.66480 WP_001764145.1.66506 WP_001764145.1.66665 WP_001764145.1.66681 WP_001764145.1.66684 WP_001764145.1.66755 WP_001764145.1.66759 WP_001764145.1.66801 WP_001764145.1.66860 WP_001764145.1.66953 WP_001764145.1.66955 WP_001764145.1.66981 WP_001764145.1.67024 WP_001764145.1.67042 WP_001764145.1.67101 WP_001764145.1.67143 WP_001764145.1.67201 WP_001764145.1.67211 WP_001764145.1.67237 WP_001764145.1.67336 WP_001764145.1.67339 WP_001764145.1.67387 WP_001764145.1.67394 WP_001764145.1.67397 WP_001764145.1.67403 WP_001764145.1.67430 WP_001764145.1.67442 WP_001764145.1.67539 WP_001764145.1.67556 WP_001764145.1.67576 WP_001764145.1.67604 WP_001764145.1.67619 WP_001764145.1.67625 WP_001764145.1.67627 WP_001764145.1.67641 WP_001764145.1.67657 WP_001764145.1.67673 WP_001764145.1.67700 WP_001764145.1.67718 WP_001764145.1.67729 WP_001764145.1.67774 WP_001764145.1.67820 WP_001764145.1.67910 WP_001764145.1.67954 WP_001764145.1.68 WP_001764145.1.68043 WP_001764145.1.68105 WP_001764145.1.68113 WP_001764145.1.68131 WP_001764145.1.68182 WP_001764145.1.6819 WP_001764145.1.68285 WP_001764145.1.68359 WP_001764145.1.68514 WP_001764145.1.68564 WP_001764145.1.68688 WP_001764145.1.68742 WP_001764145.1.68770 WP_001764145.1.68809 WP_001764145.1.68914 WP_001764145.1.69053 WP_001764145.1.69170 WP_001764145.1.69270 WP_001764145.1.69282 WP_001764145.1.69376 WP_001764145.1.69396 WP_001764145.1.69466 WP_001764145.1.69611 WP_001764145.1.69642 WP_001764145.1.69656 WP_001764145.1.69657 WP_001764145.1.69690 WP_001764145.1.69923 WP_001764145.1.69948 WP_001764145.1.69953 WP_001764145.1.70010 WP_001764145.1.70049 WP_001764145.1.70058 WP_001764145.1.70061 WP_001764145.1.70205 WP_001764145.1.70240 WP_001764145.1.70249 WP_001764145.1.70261 WP_001764145.1.70314 WP_001764145.1.7033 WP_001764145.1.70427 WP_001764145.1.70433 WP_001764145.1.70545 WP_001764145.1.70623 WP_001764145.1.70671 WP_001764145.1.70679 WP_001764145.1.70708 WP_001764145.1.70717 WP_001764145.1.70731 WP_001764145.1.70772 WP_001764145.1.70845 WP_001764145.1.70846 WP_001764145.1.70981 WP_001764145.1.70995 WP_001764145.1.71039 WP_001764145.1.71057 WP_001764145.1.71081 WP_001764145.1.71117 WP_001764145.1.71186 WP_001764145.1.71455 WP_001764145.1.71456 WP_001764145.1.71487 WP_001764145.1.71523 WP_001764145.1.71542 WP_001764145.1.71566 WP_001764145.1.71640 WP_001764145.1.71651 WP_001764145.1.71653 WP_001764145.1.71716 WP_001764145.1.71872 WP_001764145.1.71950 WP_001764145.1.71954 WP_001764145.1.71985 WP_001764145.1.72003 WP_001764145.1.72073 WP_001764145.1.72269 WP_001764145.1.72350 WP_001764145.1.72383 WP_001764145.1.72461 WP_001764145.1.72527 WP_001764145.1.7255 WP_001764145.1.72631 WP_001764145.1.72638 WP_001764145.1.72667 WP_001764145.1.72674 WP_001764145.1.72724 WP_001764145.1.72789 WP_001764145.1.72828 WP_001764145.1.72896 WP_001764145.1.72969 WP_001764145.1.72987 WP_001764145.1.73052 WP_001764145.1.7311 WP_001764145.1.73114 WP_001764145.1.73177 WP_001764145.1.73180 WP_001764145.1.73258 WP_001764145.1.73285 WP_001764145.1.7332 WP_001764145.1.7333 WP_001764145.1.73352 WP_001764145.1.73389 WP_001764145.1.73425 WP_001764145.1.73488 WP_001764145.1.73504 WP_001764145.1.7353 WP_001764145.1.73544 WP_001764145.1.73598 WP_001764145.1.7361 WP_001764145.1.73648 WP_001764145.1.73768 WP_001764145.1.73849 WP_001764145.1.73948 WP_001764145.1.73999 WP_001764145.1.74024 WP_001764145.1.74030 WP_001764145.1.74038 WP_001764145.1.74043 WP_001764145.1.74058 WP_001764145.1.74070 WP_001764145.1.74077 WP_001764145.1.74135 WP_001764145.1.74214 WP_001764145.1.74241 WP_001764145.1.74285 WP_001764145.1.7430 WP_001764145.1.74317 WP_001764145.1.74415 WP_001764145.1.74616 WP_001764145.1.74621 WP_001764145.1.74647 WP_001764145.1.74677 WP_001764145.1.74699 WP_001764145.1.74831 WP_001764145.1.74894 WP_001764145.1.74929 WP_001764145.1.74939 WP_001764145.1.74973 WP_001764145.1.7507 WP_001764145.1.75089 WP_001764145.1.75116 WP_001764145.1.75237 WP_001764145.1.75273 WP_001764145.1.75296 WP_001764145.1.75413 WP_001764145.1.75433 WP_001764145.1.75532 WP_001764145.1.75565 WP_001764145.1.75593 WP_001764145.1.75610 WP_001764145.1.75633 WP_001764145.1.75718 WP_001764145.1.75745 WP_001764145.1.75844 WP_001764145.1.75886 WP_001764145.1.75898 WP_001764145.1.76081 WP_001764145.1.76116 WP_001764145.1.76122 WP_001764145.1.76256 WP_001764145.1.76339 WP_001764145.1.76366 WP_001764145.1.76417 WP_001764145.1.7646 WP_001764145.1.76510 WP_001764145.1.76558 WP_001764145.1.76572 WP_001764145.1.76641 WP_001764145.1.76651 WP_001764145.1.76653 WP_001764145.1.76788 WP_001764145.1.76854 WP_001764145.1.76916 WP_001764145.1.76932 WP_001764145.1.76973 WP_001764145.1.76988 WP_001764145.1.77016 WP_001764145.1.77087 WP_001764145.1.77090 WP_001764145.1.77111 WP_001764145.1.77299 WP_001764145.1.77384 WP_001764145.1.77501 WP_001764145.1.77512 WP_001764145.1.77513 WP_001764145.1.77563 WP_001764145.1.77702 WP_001764145.1.77713 WP_001764145.1.7772 WP_001764145.1.77825 WP_001764145.1.77837 WP_001764145.1.77900 WP_001764145.1.77923 WP_001764145.1.77975 WP_001764145.1.78035 WP_001764145.1.78048 WP_001764145.1.78107 WP_001764145.1.78166 WP_001764145.1.78192 WP_001764145.1.78195 WP_001764145.1.78291 WP_001764145.1.78309 WP_001764145.1.78320 WP_001764145.1.78382 WP_001764145.1.78388 WP_001764145.1.78410 WP_001764145.1.7862 WP_001764145.1.78626 WP_001764145.1.78661 WP_001764145.1.78674 WP_001764145.1.78676 WP_001764145.1.78761 WP_001764145.1.789 WP_001764145.1.78993 WP_001764145.1.79012 WP_001764145.1.79069 WP_001764145.1.79074 WP_001764145.1.79098 WP_001764145.1.79155 WP_001764145.1.79164 WP_001764145.1.79204 WP_001764145.1.79280 WP_001764145.1.79397 WP_001764145.1.79456 WP_001764145.1.79532 WP_001764145.1.79547 WP_001764145.1.79654 WP_001764145.1.7970 WP_001764145.1.79722 WP_001764145.1.79772 WP_001764145.1.79880 WP_001764145.1.79916 WP_001764145.1.80065 WP_001764145.1.80103 WP_001764145.1.80273 WP_001764145.1.80282 WP_001764145.1.80354 WP_001764145.1.80368 WP_001764145.1.80386 WP_001764145.1.80400 WP_001764145.1.80462 WP_001764145.1.8049 WP_001764145.1.80492 WP_001764145.1.80569 WP_001764145.1.80664 WP_001764145.1.80696 WP_001764145.1.80984 WP_001764145.1.81131 WP_001764145.1.81187 WP_001764145.1.81262 WP_001764145.1.81268 WP_001764145.1.81269 WP_001764145.1.81271 WP_001764145.1.8131 WP_001764145.1.81333 WP_001764145.1.81342 WP_001764145.1.81364 WP_001764145.1.81494 WP_001764145.1.81557 WP_001764145.1.81676 WP_001764145.1.81681 WP_001764145.1.8170 WP_001764145.1.81763 WP_001764145.1.81855 WP_001764145.1.81921 WP_001764145.1.81931 WP_001764145.1.81936 WP_001764145.1.81949 WP_001764145.1.82070 WP_001764145.1.82076 WP_001764145.1.82131 WP_001764145.1.82156 WP_001764145.1.8218 WP_001764145.1.82180 WP_001764145.1.82201 WP_001764145.1.82214 WP_001764145.1.82225 WP_001764145.1.8240 WP_001764145.1.82408 WP_001764145.1.82416 WP_001764145.1.8242 WP_001764145.1.82456 WP_001764145.1.82465 WP_001764145.1.82473 WP_001764145.1.82553 WP_001764145.1.82646 WP_001764145.1.82670 WP_001764145.1.82731 WP_001764145.1.82812 WP_001764145.1.82850 WP_001764145.1.82872 WP_001764145.1.8294 WP_001764145.1.82959 WP_001764145.1.83007 WP_001764145.1.8304 WP_001764145.1.83180 WP_001764145.1.83229 WP_001764145.1.83235 WP_001764145.1.83290 WP_001764145.1.83333 WP_001764145.1.83657 WP_001764145.1.83677 WP_001764145.1.8375 WP_001764145.1.83923 WP_001764145.1.83994 WP_001764145.1.84 WP_001764145.1.8406 WP_001764145.1.84076 WP_001764145.1.84110 WP_001764145.1.84127 WP_001764145.1.84150 WP_001764145.1.84230 WP_001764145.1.84252 WP_001764145.1.8431 WP_001764145.1.84345 WP_001764145.1.84369 WP_001764145.1.84401 WP_001764145.1.84435 WP_001764145.1.84567 WP_001764145.1.84631 WP_001764145.1.84727 WP_001764145.1.84744 WP_001764145.1.84773 WP_001764145.1.84945 WP_001764145.1.84967 WP_001764145.1.85004 WP_001764145.1.8502 WP_001764145.1.85039 WP_001764145.1.85153 WP_001764145.1.85273 WP_001764145.1.85339 WP_001764145.1.85511 WP_001764145.1.85512 WP_001764145.1.8557 WP_001764145.1.85606 WP_001764145.1.85635 WP_001764145.1.85646 WP_001764145.1.85665 WP_001764145.1.85669 WP_001764145.1.85688 WP_001764145.1.85728 WP_001764145.1.85746 WP_001764145.1.85811 WP_001764145.1.859 WP_001764145.1.85917 WP_001764145.1.8594 WP_001764145.1.85977 WP_001764145.1.860 WP_001764145.1.8605 WP_001764145.1.86084 WP_001764145.1.8610 WP_001764145.1.8614 WP_001764145.1.86156 WP_001764145.1.86323 WP_001764145.1.86342 WP_001764145.1.8640 WP_001764145.1.8642 WP_001764145.1.86426 WP_001764145.1.86489 WP_001764145.1.86530 WP_001764145.1.86663 WP_001764145.1.86770 WP_001764145.1.86794 WP_001764145.1.86800 WP_001764145.1.86811 WP_001764145.1.86815 WP_001764145.1.86945 WP_001764145.1.86989 WP_001764145.1.87023 WP_001764145.1.87034 WP_001764145.1.87041 WP_001764145.1.87136 WP_001764145.1.87155 WP_001764145.1.87258 WP_001764145.1.87293 WP_001764145.1.87420 WP_001764145.1.87528 WP_001764145.1.87560 WP_001764145.1.8760 WP_001764145.1.87600 WP_001764145.1.87609 WP_001764145.1.87612 WP_001764145.1.87615 WP_001764145.1.87653 WP_001764145.1.87698 WP_001764145.1.87706 WP_001764145.1.87739 WP_001764145.1.87741 WP_001764145.1.87742 WP_001764145.1.87852 WP_001764145.1.87949 WP_001764145.1.88025 WP_001764145.1.88026 WP_001764145.1.8805 WP_001764145.1.8806 WP_001764145.1.881 WP_001764145.1.88145 WP_001764145.1.88199 WP_001764145.1.88299 WP_001764145.1.88313 WP_001764145.1.88359 WP_001764145.1.88407 WP_001764145.1.88414 WP_001764145.1.88444 WP_001764145.1.88446 WP_001764145.1.88458 WP_001764145.1.88501 WP_001764145.1.88538 WP_001764145.1.88547 WP_001764145.1.886 WP_001764145.1.88647 WP_001764145.1.88648 WP_001764145.1.88692 WP_001764145.1.88707 WP_001764145.1.88727 WP_001764145.1.88772 WP_001764145.1.88850 WP_001764145.1.8889 WP_001764145.1.88892 WP_001764145.1.88894 WP_001764145.1.89182 WP_001764145.1.89298 WP_001764145.1.89308 WP_001764145.1.89314 WP_001764145.1.89328 WP_001764145.1.89332 WP_001764145.1.89343 WP_001764145.1.89395 WP_001764145.1.8940 WP_001764145.1.89449 WP_001764145.1.8947 WP_001764145.1.89503 WP_001764145.1.89591 WP_001764145.1.89612 WP_001764145.1.89668 WP_001764145.1.89706 WP_001764145.1.89713 WP_001764145.1.89733 WP_001764145.1.89796 WP_001764145.1.89804 WP_001764145.1.89845 WP_001764145.1.89888 WP_001764145.1.89911 WP_001764145.1.8995 WP_001764145.1.89952 WP_001764145.1.90007 WP_001764145.1.9011 WP_001764145.1.90196 WP_001764145.1.90240 WP_001764145.1.90274 WP_001764145.1.90280 WP_001764145.1.90330 WP_001764145.1.90338 WP_001764145.1.90365 WP_001764145.1.90428 WP_001764145.1.90489 WP_001764145.1.90513 WP_001764145.1.90582 WP_001764145.1.90713 WP_001764145.1.90794 WP_001764145.1.90796 WP_001764145.1.90811 WP_001764145.1.9091 WP_001764145.1.91067 WP_001764145.1.91164 WP_001764145.1.91205 WP_001764145.1.91239 WP_001764145.1.91291 WP_001764145.1.91313 WP_001764145.1.9135 WP_001764145.1.91506 WP_001764145.1.91557 WP_001764145.1.91597 WP_001764145.1.91715 WP_001764145.1.9187 WP_001764145.1.91870 WP_001764145.1.92018 WP_001764145.1.92087 WP_001764145.1.92098 WP_001764145.1.92156 WP_001764145.1.92172 WP_001764145.1.92240 WP_001764145.1.92243 WP_001764145.1.92327 WP_001764145.1.92470 WP_001764145.1.92477 WP_001764145.1.92545 WP_001764145.1.92570 WP_001764145.1.92588 WP_001764145.1.926 WP_001764145.1.92633 WP_001764145.1.92649 WP_001764145.1.92676 WP_001764145.1.92705 WP_001764145.1.9271 WP_001764145.1.92734 WP_001764145.1.92810 WP_001764145.1.92823 WP_001764145.1.92987 WP_001764145.1.93007 WP_001764145.1.93022 WP_001764145.1.93103 WP_001764145.1.93105 WP_001764145.1.93111 WP_001764145.1.93121 WP_001764145.1.93168 WP_001764145.1.93184 WP_001764145.1.93221 WP_001764145.1.93223 WP_001764145.1.93239 WP_001764145.1.93302 WP_001764145.1.9336 WP_001764145.1.93387 WP_001764145.1.93469 WP_001764145.1.93511 WP_001764145.1.93512 WP_001764145.1.93635 WP_001764145.1.93657 WP_001764145.1.9374 WP_001764145.1.9375 WP_001764145.1.93754 WP_001764145.1.93780 WP_001764145.1.93828 WP_001764145.1.93842 WP_001764145.1.93843 WP_001764145.1.93875 WP_001764145.1.93909 WP_001764145.1.93919 WP_001764145.1.93938 WP_001764145.1.93984 WP_001764145.1.9399 WP_001764145.1.94017 WP_001764145.1.94079 WP_001764145.1.94097 WP_001764145.1.94107 WP_001764145.1.94142 WP_001764145.1.94215 WP_001764145.1.94303 WP_001764145.1.94365 WP_001764145.1.94390 WP_001764145.1.94415 WP_001764145.1.94492 WP_001764145.1.94510 WP_001764145.1.94527 WP_001764145.1.94573 WP_001764145.1.94579 WP_001764145.1.94586 WP_001764145.1.94593 WP_001764145.1.94650 WP_001764145.1.94659 WP_001764145.1.94662 WP_001764145.1.94700 WP_001764145.1.94745 WP_001764145.1.94782 WP_001764145.1.94815 WP_001764145.1.94820 WP_001764145.1.94850 WP_001764145.1.94851 WP_001764145.1.94864 WP_001764145.1.94952 WP_001764145.1.95006 WP_001764145.1.95055 WP_001764145.1.95076 WP_001764145.1.95099 WP_001764145.1.95165 WP_001764145.1.95239 WP_001764145.1.95246 WP_001764145.1.9525 WP_001764145.1.95255 WP_001764145.1.95265 WP_001764145.1.95338 WP_001764145.1.95412 WP_001764145.1.95530 WP_001764145.1.95547 WP_001764145.1.95590 WP_001764145.1.95625 WP_001764145.1.95675 WP_001764145.1.95716 WP_001764145.1.95776 WP_001764145.1.95884 WP_001764145.1.95890 WP_001764145.1.95906 WP_001764145.1.96025 WP_001764145.1.96044 WP_001764145.1.96054 WP_001764145.1.96094 WP_001764145.1.96127 WP_001764145.1.96144 WP_001764145.1.96188 WP_001764145.1.96211 WP_001764145.1.96212 WP_001764145.1.96319 WP_001764145.1.9633 WP_001764145.1.96359 WP_001764145.1.96539 WP_001764145.1.96552 WP_001764145.1.96610 WP_001764145.1.96625 WP_001764145.1.96635 WP_001764145.1.9664 WP_001764145.1.96675 WP_001764145.1.9670 WP_001764145.1.96750 WP_001764145.1.96792 WP_001764145.1.96801 WP_001764145.1.96803 WP_001764145.1.96925 WP_001764145.1.96938 WP_001764145.1.96946 WP_001764145.1.96957 WP_001764145.1.96978 WP_001764145.1.97026 WP_001764145.1.97028 WP_001764145.1.97079 WP_001764145.1.97154 WP_001764145.1.97184 WP_001764145.1.97291 WP_001764145.1.97422 WP_001764145.1.97441 WP_001764145.1.97497 WP_001764145.1.97505 WP_001764145.1.97599 WP_001764145.1.97606 WP_001764145.1.97615 WP_001764145.1.97646 WP_001764145.1.97690 WP_001764145.1.97819 WP_001764145.1.97840 WP_001764145.1.97938 WP_001764145.1.97986 WP_001764145.1.98036 WP_001764145.1.98080 WP_001764145.1.98086 WP_001764145.1.98158 WP_001764145.1.98263 WP_001764145.1.98418 WP_001764145.1.98448 WP_001764145.1.98457 WP_001764145.1.9850 WP_001764145.1.98502 WP_001764145.1.98607 WP_001764145.1.98731 WP_001764145.1.98762 WP_001764145.1.9877 WP_001764145.1.98801 WP_001764145.1.98818 WP_001764145.1.99163 WP_001764145.1.99335 WP_001764145.1.99350 WP_001764145.1.99360 WP_001764145.1.99363 WP_001764145.1.99369 WP_001764145.1.99388 WP_001764145.1.99397 WP_001764145.1.99463 WP_001764145.1.99483 WP_001764145.1.99546 WP_001764145.1.99579 WP_001764145.1.99595 WP_001764145.1.99671 WP_001764145.1.99676 WP_001764145.1.99764 WP_001764145.1.99829 WP_001764145.1.99837 WP_001764145.1.99841 WP_001764145.1.9992 WP_001764145.1.99996 AE014613|CDS_643168-642011 AL513382|CDS_2361544-2362701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]