SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383788523|ref|YP_005473092.1| from Caldisericum exile AZM16c01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383788523|ref|YP_005473092.1|
Domain Number 1 Region: 10-235
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 9.92e-55
Family PP-loop ATPase 0.0000625
Further Details:      
 
Domain Number 2 Region: 358-441
Classification Level Classification E-value
Superfamily PheT/TilS domain 9.02e-16
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.038
Further Details:      
 
Domain Number 3 Region: 213-308
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.00000000889
Family MesJ substrate recognition domain-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383788523|ref|YP_005473092.1|
Sequence length 451
Comment tRNA(Ile)-lysidine synthase [Caldisericum exile AZM16c01]
Sequence
MEEILEKVLKTIEKYKLIQKNEKVLLAVSGGIDSMTMLSIFHKIKDIIQVEIGVATFDHG
IRSESKDEIKIVEEYSKKLQVPFFFGVGNALKVHLKTKRNLEDVAREQRLKFLREVKEAN
SFNKIALAHNKNDFVETFFMHLLKGSGLKGITSMLAIEEDLIRPLVGVTREEIENYAKNE
GIPYIIDLSNYNLSYERNRLRYQILPLIKSSYPNFMDHVLNFSDIALNDENLLDKITAIE
LEGIKRQNNEYSINLFKPLSLSIKRRIIKELLGENANYERVNMIIEFIESNKKKFSIGKD
IYVAKTGNSFYIEHGTPFTIERSYILKIPGITTIPEAEVKIISEILESKKEFDLNDKTSA
VFDLNFLKFPISVRFRKEGDIIEIENGKKKLQDLFVDLKVRRDIRHKVPIVVDNDDKILW
VCGVRRSTIAKIGKDTRKVLFLKIVPLTQNL
Download sequence
Identical sequences I0GJQ2
WP_014453392.1.31382 gi|383788523|ref|YP_005473092.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]