SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383788672|ref|YP_005473241.1| from Caldisericum exile AZM16c01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383788672|ref|YP_005473241.1|
Domain Number 1 Region: 211-401
Classification Level Classification E-value
Superfamily PheT/TilS domain 2.62e-64
Family B3/B4 domain of PheRS, PheT 0.0000302
Further Details:      
 
Domain Number 2 Region: 475-687
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.84e-36
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00015
Further Details:      
 
Domain Number 3 Region: 696-794
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 4.84e-27
Family Anticodon-binding domain of PheRS 0.00057
Further Details:      
 
Domain Number 4 Region: 35-187
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.17e-22
Family Myf domain 0.0024
Further Details:      
 
Domain Number 5 Region: 413-482
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000000000174
Family Domains B1 and B5 of PheRS-beta, PheT 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383788672|ref|YP_005473241.1|
Sequence length 797
Comment phenylalanyl-tRNA synthetase subunit beta [Caldisericum exile AZM16c01]
Sequence
MIVSYNLLKELIDFPYTPKELSEKLTYVGIEVEKVENVEKRFENVVSGKVLEVYPIEGTK
LFKVKVDAGDGIVEVITAATNVKQNDIVPYAKVNSKISDGRIIKEKEFEGYCSQGMLLSY
VELGLDPDTLSNDEKDGIFILPPDTPIGVGFEKLFPVEDTFLELSLLPDRADAFYVLGVA
RWIEILLARDEGRRANFDKFKFDLFDDANLPETPFPVEILHKEHCSFYSGRLIKDVTIKK
SSYKLRKKLFSLRIRPINNIVDITNYVARMYGQPLHAFDFDKLKGKIIVRLATAEEKIKT
LDEIERTLTSKNLLITDETGPIAIAGVMGGFDTAVTENTKNIFLESAYFTPSTISKSSRS
LGLITDASSLFEKGVDPQFTPTASLIATKLILEEAGGLAFKDRVTDFRKPKESVKLRVSK
ASSLLGEEMHEEEIKKYFDIEGFNYIEKEGVFSVTPPSFRQDISIEEDLIEEIVRMRGYN
EFSEKPIIAPLRSGTFEPILKFNAKLRDILLHLGLNEIVTSTLTNKEILTRFNLYEDSVI
KLLNPLTEDMSLLRPTLFVGSFEVAQRNLNINVENLSLFEIGKVFFKMGNELSEEYRMSI
FLKGNRIGKNPYGRNLPYDYYYLKGLIESIFEEFGISAQFVKYEQPHMHPYQTSKVIVNG
NFFGYLGKINPDLLDDAYYAELKVNELFKEANLENKFSQFSLYPPVKRDIAIIVDKSVEE
ILVRKAIRDSNIKELKSIILFDIYEGKPLPEGKKNLAYSLEFISYDRTLQGAEVDEFIKK
IEENIINKTGGTLRKNE
Download sequence
Identical sequences I0GK51
WP_014453540.1.31382 gi|383788672|ref|YP_005473241.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]