SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383788786|ref|YP_005473355.1| from Caldisericum exile AZM16c01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383788786|ref|YP_005473355.1|
Domain Number 1 Region: 1-83
Classification Level Classification E-value
Superfamily Ribosomal protein L6 6.02e-26
Family Ribosomal protein L6 0.00011
Further Details:      
 
Domain Number 2 Region: 84-176
Classification Level Classification E-value
Superfamily Ribosomal protein L6 9.16e-26
Family Ribosomal protein L6 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383788786|ref|YP_005473355.1|
Sequence length 181
Comment 50S ribosomal protein L6 [Caldisericum exile AZM16c01]
Sequence
MSRIGKMPIPIPQGVTVNILDGNVVEVKGPKGALKKEFHPEMKIEIVDNAIVVKRNSDKP
FYKALHGTTRALLNNMVVGVTKGFSKRLIINEKTYKGEVKGRKVQFELGYSHPILMDIPE
GLNVTIEGQVITVSGIDKEAVGAFAQKIRHLRKVDPYKVKGIIYEGEKIRRKAGKTVASG
K
Download sequence
Identical sequences I0GKG5
gi|383788786|ref|YP_005473355.1| WP_014453649.1.31382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]