SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383788718|ref|YP_005473287.1| from Caldisericum exile AZM16c01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383788718|ref|YP_005473287.1|
Domain Number 1 Region: 15-241
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.44e-58
Family Alanine racemase-like, N-terminal domain 0.000019
Further Details:      
 
Domain Number 2 Region: 239-372
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 4.19e-45
Family Alanine racemase 0.0000866
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383788718|ref|YP_005473287.1|
Sequence length 373
Comment alanine racemase [Caldisericum exile AZM16c01]
Sequence
MDNEIEMNRPTWVEVDLQSIRNNFLKIKEKVFFRDVICVVKADAYGLGASKIAATLEEVG
ADGFAVASMEEALTLRESQIKKPILVLGYVDTRNLHLASLNEIRITLFDKDFIKRLKEYR
NETPLKIHVKIDTGMHRLGISLEEVPFVFEELSKFKSVIVEGVYTHFASADSDPDYTRFQ
ISQFNRVLEYLKERNACPKVVHAANSAAVLNFEKAYYTAVRPGILLYGITPNHQKIQLES
DFKEAVSIKTRIVKVSYYKKGERISYGGTYQTEKESLIATVPIGYADFIPRNLSNKGYVL
VKGLKAPIVGVITMDMMMIDVTGFPYIHPGNEVVIVGSQGENKITMEEFATLSNTIPYEI
LTRLNKRIKRIYK
Download sequence
Identical sequences I0GK97
WP_014453581.1.31382 gi|383788718|ref|YP_005473287.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]