SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Physo1_1|143188|estExt_fgenesh1_pg.C_1310030 from Phytophthora sojae 1.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Physo1_1|143188|estExt_fgenesh1_pg.C_1310030
Domain Number 1 Region: 221-567
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 4.44e-79
Family IF2B-like 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Physo1_1|143188|estExt_fgenesh1_pg.C_1310030
Sequence length 577
Sequence
MGGAIETKKLYLTSSEAMADSRSPVLEPGADLKHLESMLDDRNQKKRGKKSDEPYQGKLE
GWSPANHHGDDAVPPMEKLSLGPAADADGAKPQETAAGADDNKKLSKAERKKLAAEAFAK
AGGVPKREKLSKAERRAQQEASRQKKEAGGAKPKKSDATGPTAPMPTNARLQYDDAKKMA
RRSKAAVVVRTQAQKQVEMFSHLPQYERESSLSLNVGFSNKEEVHAAVLALGLKYAESKI
SGGNARCIAMITAFKEVIDDYVTPPDKQLRRDLDKRLRPLIQYLIDCRPHGIGMGNAIRR
LRRVIGSTPPELSEEEAKRRIREEMDDYVQSRILLASRAVVKNAQSKISAGDVILTYARA
NVVEELLLETAKTSPEIAATLRVIVVDSRPHYEGRKMVSVLAGAGLQCSYLQINALSYIM
REVTKVFLGAAAFMSNGVAVARVGTALVAMTAHEANVPVLFCCETYKFSDRVQLDAITHN
ELGDPDELVSSYCTDKSRSRRRTGGGASGNASAGSSSGHVLSDWRDLADLKLLNLVYDVT
PIEYVSLVVTELGMIPPTSIPAVLREYSRDGLADGAL
Download sequence
Identical sequences 67593.JGI143188 jgi|Physo1_1|143188|estExt_fgenesh1_pg.C_1310030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]