SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81230339|ref|YP_398718.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81230339|ref|YP_398718.1|
Domain Number 1 Region: 59-362
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 1.57e-92
Family Heme-dependent catalases 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81230339|ref|YP_398718.1|
Sequence length 365
Comment putative catalase [Synechococcus elongatus PCC 7942]
Sequence
MTVVIYYMTVLCKAFDCFNSSAVENTMIRIRNRWFRWLAIALASLVASIGIATVGFAATG
VTPDQVLSAIEGTFGVNVGQRRNHIKGTCAVGNFVATTEAKTYSRSPLFSGQSIPVVARF
SLAGGNPKAPDTAKNPRGLGLQFQLPNNRFLNMALLNTPVFGVASPEGFYENILAIRPDP
TTGKPDPEKVKAFREKYPENKAQAAFLASNNPPTSYANTSYFGLHAFKFINQTNQTRLVR
WQFVPQDGEKRLTDAELQAAPANFLEQKLIERTQDSPVKWDFWITLGQPGDAEDNPTIAW
PSDRQQVKVGTLTLTAASPQPGAACEGINYDPLVLSDGIEPTNDPVLQFRSGVYALSYSK
RTRGL
Download sequence
Identical sequences gi|81230339|ref|YP_398718.1| 1140.Synpcc7942_B2620 gi|81230339|ref|YP_398718.1|NC_007595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]