SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81298820|ref|YP_399028.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81298820|ref|YP_399028.1|
Domain Number 1 Region: 174-398
Classification Level Classification E-value
Superfamily Argininosuccinate synthetase, C-terminal domain 8.89e-93
Family Argininosuccinate synthetase, C-terminal domain 0.00000166
Further Details:      
 
Domain Number 2 Region: 5-173
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 9.48e-45
Family N-type ATP pyrophosphatases 0.00000598
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81298820|ref|YP_399028.1|
Sequence length 400
Comment argininosuccinate synthase [Synechococcus elongatus PCC 7942]
Sequence
MGRAKRVVLAYSGGVDTSVCIPYLKQEWGVEEVITLAADLGQGDELGPIRQKALDSGAVE
SLVIDATAEFVRDYAFPAIQANSLYEGRYPLSTALARPLIAKLLVEAAAKYGADAVAHGC
TGKGNDQVRFDVSIAALNPDLKVLAPAREWGMSREETIAYGERFGIPAPVKKSSPYSIDR
NLLGRSIEAGPLEDPLHEPLEEVYALTKAIANTPDEPAYIELGFDQGLPVTLNGQALAPV
ALIQQLNAIAGEHGIGRIDMIENRLVGIKSREIYETPALLVLIQAHQDLESLVLTADVSQ
YKRGIENSWSNLVYNGLWYSPLKAALDAFIQQTQQRVTGTVRLRLFKGNATVVGRSSEQS
LYSPDMATYGAEDRFDHKAAEGFIYVWGMPTRIWSQTHRA
Download sequence
Identical sequences Q31SC8 Q5N1Z2
1140.Synpcc7942_0009 269084.syc1488_c gi|56751497|ref|YP_172198.1| gi|81298820|ref|YP_399028.1| WP_011243798.1.45845 WP_011243798.1.5740 WP_011243798.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]