SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81298830|ref|YP_399038.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81298830|ref|YP_399038.1|
Domain Number 1 Region: 138-355
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.49e-54
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000145
Further Details:      
 
Domain Number 2 Region: 440-581
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.96e-34
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000437
Further Details:      
 
Domain Number 3 Region: 8-137
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.93e-29
Family Duplicated SiR/NiR-like domains 1 and 3 0.0064
Further Details:      
 
Domain Number 4 Region: 356-434
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 5.98e-17
Family Duplicated SiR/NiR-like domains 1 and 3 0.0047
Further Details:      
 
Weak hits

Sequence:  gi|81298830|ref|YP_399038.1|
Domain Number - Region: 573-623
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.00189
Family Omega transcriptional repressor 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|81298830|ref|YP_399038.1|
Sequence length 624
Comment sulfite reductase subunit beta [Synechococcus elongatus PCC 7942]
Sequence
MSPTAAPQKLSKVEDLKARSQYLLEPILSQLQEESTHFNEDGIQILKFHGSYQQDNRDNR
VKGQEKDFQFMLRLRSPGGYIPPQLYLTLDQLADDYGNGTLRATTRQAFQLHGILKRDLK
TVIRRIVENLGSTISACGDVNRNVMAPPAPFRDRPEYEWARTYANNIADLLTPESGAYYE
LWLDGEKVLSGEPDPAVLAARRNPKGRVADSVEPLYSDRYLPRKFKIAVTVPGDNSIDLF
TQDIGLVVIGNDRGELEGFNVYVGGGMGRTHNKEETFARLADPLGFVPAADIYAAVQAIV
ATQRDYGDRSNRRHARMKYLIHDWGIAKFKEAVESVFGKAIAPVRELPPFRYRDYLGWHE
QGDGKWFLGLPITSGRIKDDGNWQLRSALREIVSRWQLPLLLTGSQDVLIYDVQPGDRAA
IDKLLRDRGVHTVEAIDSLQRYAMACPALPTCGLAITESERALPGLLVRIRRLLEEQGLP
DEHFVVRMTGCPNGCARPYMAELAFVGSAPNTYQLWLGGSPDQTRLARPFIDRLADGDVE
TQLRPLFVFFKQSRQAGESFGDFCDRVGFDALRQFSESYQHEAAKPRYRVGLRADVHGRL
KAEADKRGVSLTDLACEAIAAYLR
Download sequence
Identical sequences P30008
gi|81298830|ref|YP_399038.1| WP_011377403.1.45845 WP_011377403.1.5740 WP_011377403.1.95485 1140.Synpcc7942_0019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]