SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81298853|ref|YP_399061.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81298853|ref|YP_399061.1|
Domain Number 1 Region: 2-75
Classification Level Classification E-value
Superfamily L28p-like 1.35e-26
Family Ribosomal protein L28 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81298853|ref|YP_399061.1|
Sequence length 78
Comment 50S ribosomal protein L28 [Synechococcus elongatus PCC 7942]
Sequence
MSRVCQLTGKKANNAYAISHSHRRTKRLQNVNLQEKRIWWPEGNRFVKLRLSTKAIKTLQ
KKGLSAYARELGIDLKRL
Download sequence
Identical sequences Q31S95 Q5N223
gi|81298853|ref|YP_399061.1| WP_011243767.1.45845 WP_011243767.1.5740 WP_011243767.1.95485 gi|56751466|ref|YP_172167.1| 1140.Synpcc7942_0042 269084.syc1457_d

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]