SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81298897|ref|YP_399105.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81298897|ref|YP_399105.1|
Domain Number 1 Region: 142-476,505-575
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.47e-127
Family Amylase, catalytic domain 0.000000698
Further Details:      
 
Domain Number 2 Region: 16-156
Classification Level Classification E-value
Superfamily E set domains 1.32e-41
Family E-set domains of sugar-utilizing enzymes 0.0033
Further Details:      
 
Domain Number 3 Region: 597-693
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 5.83e-22
Family alpha-Amylases, C-terminal beta-sheet domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81298897|ref|YP_399105.1|
Sequence length 694
Comment isoamylase [Synechococcus elongatus PCC 7942]
Sequence
MTVSSRRPESTVAVDPGQSYPLGATVYPTGVNFSLYTKYATGVELLLFDDPEGAQPQRTV
RLDPHLNRTSFYWHVFIPGIRSGQVYAYRVFGPYAPDRGLCFNPNKVLLDPYARGVVGWQ
HYSREAAIKPSNNCVQALRSVVVDPSDYDWEGDRHPRTPYARTVIYELHVGGFTKHPNSG
VAPEKRGTYAGLIEKIPYLQSLGVTAVELLPVHQFDRQDAPLGRENYWGYSTMAFFAPHA
AYSSRHDPLGPVDEFRDLVKALHQAGIEVILDVVFNHTAEGNEDGPTLSFKGLANSTYYL
LDEQAGYRNYTGCGNTVKANNSIVRSLILDCLRYWVSEMHVDGFRFDLASVLSRDANGNP
LSDPPLLWAIDSDPVLAGTKLIAEAWDAAGLYQVGTFIGDRFGTWNGPFRDDIRRFWRGD
QGCTYALSQRLLGSPDVYSTDQWYAGRTINFITCHDGFTLRDLVSYSQKHNFANGENNRD
GTNDNYSWNYGIEGETDDPTILSLRERQQRNLLATLFLAQGTPMLTMGDEVKRSQQGNNN
AYCQDNEISWFDWSLCDRHADFLVFSRRLIELSQSLVMFQQNELLQNEPHPRRPYAIWHG
VKLKQPDWALWSHSLAVSLCHPRQQEWLYLAFNAYWEDLRFQLPRPPRGRVWYRLLDTSL
PNLEACHLPDEAKPCLRRDYIVPARSLLLLMARA
Download sequence
Identical sequences A0A0H3K623 Q31S51
1140.Synpcc7942_0086 269084.syc1418_d NYSGRC-FDAO-ABB56118 gi|56751427|ref|YP_172128.1| gi|81298897|ref|YP_399105.1| WP_011243730.1.45845 WP_011243730.1.5740 WP_011243730.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]