SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81298950|ref|YP_399158.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81298950|ref|YP_399158.1|
Domain Number 1 Region: 383-578
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.7e-69
Family Pyruvate oxidase and decarboxylase PP module 0.0000112
Further Details:      
 
Domain Number 2 Region: 200-374
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 2.13e-64
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000386
Further Details:      
 
Domain Number 3 Region: 6-193
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.72e-64
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000369
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|81298950|ref|YP_399158.1|
Sequence length 612
Comment acetolactate synthase 3 catalytic subunit [Synechococcus elongatus PCC 7942]
Sequence
MQLQTVTIQQRATGAYALIDSLCQHGVKHIFGYPGGAILPIYDELHRAEAAGRVQHILVR
HEQGAVHAADAYSRATGEVGVCFATSGPGATNLVTGIATAQMDSIPMVVVTGQVPRTAIG
TDAFQETDIYGITLPIVKHSYVVRDPRDMARIVAEAFHIAQSGRPGPVLIDVPKDVGTEE
FDYVPVAPGDIRLPGYRPTTRGNPRQIAQAIALVKVARRPLLYVGGGAITAGAHAELRAF
AERFQLPVTTTLMGKGAFDERHPLALGMLGMHGTAYANFAVSECDLLIAVGARFDDRVTG
KLDEFASKAQVIHVDIDPAEVGKNRVPEVPIVGDVRQVLNELLARAEEQISADDATRTQP
WLDRIAYWKREYPLQIPYYADVLSPQQVIHSLGEAAPDAYFTTDVGQHQMWAAQFIKNGP
RRWISSAGLGTMGFGMPAAMGAQMALPDDTVICVAGDASILMNIQELGTLAQYNIPIKVV
VVNNGWQGMVRQWQEAFYDERYSNSNMERGMPDFVKLAEAFGIKGMRVSHPDELQAAIAE
MLAFDGPVFLDAIVKRDENCYPMVPSGHSNAQMLGLPKDPTLDLDLAIATCSSCGAKTLP
SHKFCPDCGAKL
Download sequence
Identical sequences Q31RZ8
WP_011377461.1.45845 WP_011377461.1.95485 gi|81298950|ref|YP_399158.1| 1140.Synpcc7942_0139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]