SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81299000|ref|YP_399208.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299000|ref|YP_399208.1|
Domain Number 1 Region: 241-468
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.87e-56
Family N-type ATP pyrophosphatases 0.00000183
Further Details:      
 
Domain Number 2 Region: 59-281
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 1.32e-55
Family Class I glutamine amidotransferases (GAT) 0.0000062
Further Details:      
 
Domain Number 3 Region: 455-575
Classification Level Classification E-value
Superfamily GMP synthetase C-terminal dimerisation domain 1.1e-52
Family GMP synthetase C-terminal dimerisation domain 0.0000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|81299000|ref|YP_399208.1|
Sequence length 575
Comment GMP synthase [Synechococcus elongatus PCC 7942]
Sequence
MGESSARKPNISVSGRWLVHPAIAAFSSAFPGCFCPLPSPAVTLQTEMEAALEVAALNRE
MLIILDFGSQYSELIARRIRETQVYSEVLSYRTTADQIRQLSPKGIILSGGPNSVYDDYA
PVCDPEIWNLGIPVLGVCYGMQLMVQQLGGQVDRAERGEYGKAALVIDDPTDLLTNVEPG
STMWMSHGDSVKTMPEGFELLAHTDNTPCAAIADHQRKFYGVQFHPEVVHSVHGMALIRN
FVYHICDCEPTWTTETFVEEAIREIRARVGDKRVLLALSGGVDSSTLAFLLHRAIGDQLT
CMFIDQGFMRKGEPERLMEVFNEKFKIHVEYIQARDRFLQRLEGITDPEEKRKRIGHEFI
RVFEEESRRLGPFDYLAQGTLYPDVIESADTNVDPKTGERVAVKIKSHHNVGGLPKDLQF
KLVEPLRRLFKDEVRQVGRSLGLPEEIVKRHPFPGPGLAIRILGEVTAEKLNILRDADLI
VRQEVNRQGYYDEFWQAFAVLLPVKSVGVMGDKRTYAYPVVLRFVSSEDGMTADWSRAPY
DLLETISNRIVNEVKGVNRVVYDITSKPPGTIEWE
Download sequence
Identical sequences Q31RU8
gi|81299000|ref|YP_399208.1| 1140.Synpcc7942_0189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]