SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81299006|ref|YP_399214.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299006|ref|YP_399214.1|
Domain Number 1 Region: 38-135
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 3.66e-31
Family Pentapeptide repeats 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81299006|ref|YP_399214.1|
Sequence length 142
Comment hypothetical protein Synpcc7942_0195 [Synechococcus elongatus PCC 7942]
Sequence
MKASILLGSALALLLIAPPLRAENPVQVRQLLETGACAGCDLQDADLTGAHLIGADLRNA
DLAGANLTGVNLEGADLTGADLTGANLSRAYLTNAVFADADLRNANLSGVTMYHADVSGA
QLSGINLAGATLGGTAINIGGQ
Download sequence
Identical sequences A0A0H3K5R5 Q31RU2
WP_011243628.1.45845 WP_011243628.1.5740 WP_011243628.1.95485 gi|56751325|ref|YP_172026.1| gi|81299006|ref|YP_399214.1| 1140.Synpcc7942_0195 269084.syc1316_c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]