SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81299017|ref|YP_399225.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299017|ref|YP_399225.1|
Domain Number 1 Region: 167-460
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 5.42e-45
Family Monomeric nicotinate phosphoribosyltransferase C-terminal domain 0.079
Further Details:      
 
Weak hits

Sequence:  gi|81299017|ref|YP_399225.1|
Domain Number - Region: 80-131
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 0.0314
Family NadC N-terminal domain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|81299017|ref|YP_399225.1|
Sequence length 462
Comment nicotinate phosphoribosyltransferase [Synechococcus elongatus PCC 7942]
Sequence
MDLNLLFDTDSYKVSHWLQYPADTTAIGAYLESRGGDCSHTLFFGLQYLLLRYFFQPITS
ADIQEAAALFQAHGLPFNQAGWQRVCDRYGGYLPLRIRAVPEGSLVPTGNILLTVESTDP
ELAWLATWVETLLLRVWYPITVATRSWQLRQIIQQALEQSAENPAAEIDFKLHDFGSRGV
SSQESAAIGGLAHLVNFQGTDTIAALLAGQRYYDCAIAGFSIPAAEHSTITAWGPSGELD
AYRNMLDRFANPGSVVAVVSDSYDLWHAVDQLWGEDLRDRILQSGATVVIRPDSGNPEQI
VPELLRRLAAKFGCDRNQKGYQVLRSVRVIQGDGITVDSLPKVLQAVMAAGFSASNVAFG
MGGGLLQQVNRDTQRFAYKCSWIERSGQVIPICKRPATDLRKASKAGRLDLIRDREGQYR
TVSLLTSEPDPQSCLQTVFENGAIVRRQSLQEIRDRARSETR
Download sequence
Identical sequences A0A0H3K2M5 Q31RT1
1140.Synpcc7942_0206 269084.syc1305_c gi|56751314|ref|YP_172015.1| gi|81299017|ref|YP_399225.1| WP_011243617.1.45845 WP_011243617.1.5740 WP_011243617.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]