SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81299061|ref|YP_399269.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299061|ref|YP_399269.1|
Domain Number 1 Region: 31-138
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.83e-27
Family Pentapeptide repeats 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81299061|ref|YP_399269.1|
Sequence length 155
Comment hypothetical protein Synpcc7942_0250 [Synechococcus elongatus PCC 7942]
Sequence
MTGLWFLAMAIASPLRGPEAIQALIATNQCSGCNFYAVDLRFRRLPNAQLAGAMLAQADL
SFTDLSNANLQGSSLAGADLTGANLNGADLRGANLSRAILTRAQLTGAQLAGANFREAYL
LDAIGPDLRQAQLCEATLPNGQFGPFCQLPPPSGR
Download sequence
Identical sequences A0A0H3K360 Q31RN7
1140.Synpcc7942_0250 269084.syc1263_c gi|56751272|ref|YP_171973.1| WP_011243575.1.45845 WP_011243575.1.5740 WP_011243575.1.95485 gi|81299061|ref|YP_399269.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]