SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81299065|ref|YP_399273.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299065|ref|YP_399273.1|
Domain Number 1 Region: 29-490
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 1.44e-173
Family Type II DNA topoisomerase 0.000000000374
Further Details:      
 
Domain Number 2 Region: 502-845
Classification Level Classification E-value
Superfamily GyrA/ParC C-terminal domain-like 1.14e-93
Family GyrA/ParC C-terminal domain-like 0.0000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|81299065|ref|YP_399273.1|
Sequence length 856
Comment DNA gyrase subunit A [Synechococcus elongatus PCC 7942]
Sequence
MSAQERIIQTDLRNEMSRSYLEYAMSVIVGRALPDARDGLKPVHRRILYAMYELGLTPDR
PFRKCARVVGEVLGKYHPHGDTAVYDALVRMAQDFSMRSPLIDGHGNFGSIDNDPPAAMR
YTESRLKPLTTDGLLQDIEAETVDFSDNFDGSQQEPTVLPARLPQLLLNGSSGIAVGMAT
NIPPHNPTELIAGVIALIHNPEISDRELMRHIPGPDFPTGGQVLGSAGIRDAYLTGKGSI
TMRGVATIDTIEAPGRPVRDAIIITELPYQTNKAALIERIAEMVNEKRLEGISDIRDESD
RDGMRIVIELKRDAYPQVVLNNLYKQTPLQSNFSANMLALVDGEPVLLTLKRSLEVFLDF
RIETIERRTRYELRKAEERDHLLQGLLIALGNLDAIIELIRRSADAPRAKQELIDVYGLS
EVQSDAILQMQLRRLTALEAEKIEQEHQDLQRRIEDYRDILARRERVLEIIETELEQLQQ
RFQEPRRTTLLEADGELETIDLIANEKSILLLTQQGYIKRMPVNEFTAQSRGTRGKAGAK
TKDDDSVEHFLTCCDHDNILFFSDRGVVYNLPAYRIPAASRNARGVPIVQLLPIPREERI
TSIVPVSAFSDDEYLVMLTQGGYIKKTALSAFANIRSNGLIAIALSEGDQLRWVRLAKPE
DSILIGSRKGMTIHFRASHDDLRPLGRATRGVRAMSLRSGDTLISMDVLPASLTANMTET
GDEDEADDAVEVVASPGPWVLVVTAQGLGKRVPVHQFRLQKRAGLGLRAIKFRSKQDELV
SLRIVESGDELVMISQRSVIIRQASDAIPQQSRAATGVRVQRLDADDVLAAVALVPPGEE
ELDETSEDAIASDEPN
Download sequence
Identical sequences A0A0H3K8X7 Q31RN3
WP_011243571.1.45845 WP_011243571.1.5740 WP_011243571.1.95485 1140.Synpcc7942_0254 269084.syc1259_c gi|56751268|ref|YP_171969.1| gi|81299065|ref|YP_399273.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]