SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81299073|ref|YP_399281.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299073|ref|YP_399281.1|
Domain Number 1 Region: 59-325
Classification Level Classification E-value
Superfamily PLP-binding barrel 2.75e-77
Family Alanine racemase-like, N-terminal domain 0.00000396
Further Details:      
 
Domain Number 2 Region: 300-459
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.47e-48
Family Eukaryotic ODC-like 0.0000321
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81299073|ref|YP_399281.1|
Sequence length 464
Comment diaminopimelate decarboxylase [Synechococcus elongatus PCC 7942]
Sequence
MVSTPAAPSLNPQYPALFGTDRPSNSPNQNLFPLTASVTADGQLEVGGCRVSDLVERYGS
PLYILDEQTLRAACQSYRSALAHHYPGAALPIYASKAWNCLAVCALVAQEGLGIDVVSAG
ELYTALQAGVPSDRLYFHGNNKSLSELAMGVEAGCTIVVDNWQELRNLEAIAAEQQREVR
VMIRFTPGIECHTHEYIRTGHLDSKFGFDPDQLDALLAALVDQPYLRCIGLHAHIGSQIF
ELQPHADLAGVLVGAYAKALALGLPIAELNVGGGLGIRYTESDDPPSIDEWVRQVSESLV
AACQAADLPLPKLICEPGRSLIGTACVTAYQIGSRKEVPGIRTYLAVDGGMSDNPRPITY
QSTYRAVIANRLNVSDRETVTVAGKHCESGDVLLKDAELAPSQPGDILVVLATGAYNYSM
ASNYNRIARPAAVLVNNGEAQIILARESLQDLLRQDRLPVGLQA
Download sequence
Identical sequences A0A0H3K2H2 Q31RM5
WP_011243563.1.45845 WP_011243563.1.5740 WP_011243563.1.95485 gi|56751260|ref|YP_171961.1| NYSGRC-FDAO-ABB56294 gi|81299073|ref|YP_399281.1| 1140.Synpcc7942_0262 269084.syc1251_c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]