SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81299075|ref|YP_399283.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299075|ref|YP_399283.1|
Domain Number 1 Region: 19-244
Classification Level Classification E-value
Superfamily Undecaprenyl diphosphate synthase 1.7e-91
Family Undecaprenyl diphosphate synthase 0.000000797
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81299075|ref|YP_399283.1|
Sequence length 251
Comment undecaprenyl pyrophosphate synthase [Synechococcus elongatus PCC 7942]
Sequence
MTSVSNCDLRQRPPDLLPDRLPSHVAVIMDGNGRWAKQRGLPRIMGHRRGVDSLKQLLRC
CDDWGIGALTAYAFSTENWGRPHEEVDFLMTLFERVLRRELQELMAENVRIRFVGDLENL
PTSLQREIDRATSATAQNDGIRFTVATNYGGRQELLKACREIAAQVQQGQLAIDAIDESL
LSSHLYTAGVTDPDLLIRTSGEKRLSNFLLWQLAYAEIYVTDTLWPDFDRYEFYLALRDF
QSRQRRFGRLT
Download sequence
Identical sequences A0A0H3K8W9 Q31RM3
WP_011243561.1.45845 WP_011243561.1.5740 WP_011243561.1.95485 1140.Synpcc7942_0264 269084.syc1249_c gi|56751258|ref|YP_171959.1| gi|81299075|ref|YP_399283.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]