SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81299083|ref|YP_399291.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299083|ref|YP_399291.1|
Domain Number 1 Region: 8-261
Classification Level Classification E-value
Superfamily HemD-like 9.81e-64
Family HemD-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81299083|ref|YP_399291.1|
Sequence length 264
Comment uroporphyrinogen-III synthase [Synechococcus elongatus PCC 7942]
Sequence
MAEQPLIGKTILTTRAAGQSSPFAAQLRAAGAAVIEMPTLEIGPPSSWLPLDEAIAAIAD
FDWLILASANAVEAVQQRLAAQQKSWSDVPCAIAVVGQKTAQVLAAQGGKADYIPPEFIA
ESLVEHFPQPVAGQRLLFPRVETGGREQITQALQSQGAIVVEVPAYESRCPSQIPDDALI
ALRQAHLNLISFTSSKTVRNFCQLMASNLGVDWSARISGVAIASIGPQTSITCQELLGRV
EVEAQEYTLDGLLLAIEQWARQTT
Download sequence
Identical sequences A0A0H3K5J4 P42452
1140.Synpcc7942_0272 269084.syc1241_c WP_011243553.1.45845 WP_011243553.1.5740 WP_011243553.1.95485 398788 gi|56751250|ref|YP_171951.1| gi|81299083|ref|YP_399291.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]