SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81299108|ref|YP_399316.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299108|ref|YP_399316.1|
Domain Number 1 Region: 408-606
Classification Level Classification E-value
Superfamily FtsH protease domain-like 3.4e-74
Family FtsH protease domain-like 0.0000029
Further Details:      
 
Domain Number 2 Region: 154-421
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.73e-73
Family Extended AAA-ATPase domain 0.000000035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|81299108|ref|YP_399316.1|
Sequence length 613
Comment FtsH peptidase [Synechococcus elongatus PCC 7942]
Sequence
MKKRWKNAGLYALLAIVVIALGTALLDQRGTETVATWRYSEFVQRVENKQVAKVILSPDR
SSALVQAEDGDKVQVNLPNDPQLLKILTDNNVDISVRPQNQDSVWLRALSSLFFPILLLV
GLFFILRRAQGGPGNQAMNFGKSKARVQMEPQTQVTFNDVAGIDQAKLELTEVVDFLKNA
DRFTAVGAQIPKGVLLVGPPGTGKTLLAKAVAGEAGVPFFSISGSEFVEMFVGVGASRVR
DLFEQAKASAPCIVFIDEIDAVGRQRGAGLGGGNDEREQTLNQLLTEMDGFEGNSGIIIV
AATNRPDVLDAALMRPGRFDRQVVVDRPDYNGRLEILRVHARGKSLSKDIDLDKIARRTP
GFTGADLSNLLNEAAILAARRSLAEISMDEVNDAIDRVLAGPEKKDRVMSEKRKVLVAYH
EAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSEERMESGLYSRTYLQNQMAVALG
GRLAEEIVFGEEEVTTGASNDLQQVARVARQMVTRFGMSDRLGPVALGRQQGNMFLGRDI
AAERDFSEETAATIDDEVRQLVDVAYDRAKKVLIENRSILDQLAKMLVEKETVDAEELQD
LLNNNEVRMAAIA
Download sequence
Identical sequences A0A0H3K8T9 Q31RJ0
gi|81299108|ref|YP_399316.1| WP_011243527.1.45845 WP_011243527.1.5740 WP_011243527.1.95485 1140.Synpcc7942_0297 269084.syc1215_c gi|56751224|ref|YP_171925.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]