SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81299126|ref|YP_399334.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299126|ref|YP_399334.1|
Domain Number 1 Region: 3-428
Classification Level Classification E-value
Superfamily L-aspartase-like 5.03e-131
Family L-aspartase/fumarase 0.000000000774
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|81299126|ref|YP_399334.1|
Sequence length 431
Comment adenylosuccinate lyase [Synechococcus elongatus PCC 7942]
Sequence
MIERYTLPAMGGLWTDTYKLKTWLQVEIAVCEAQAELGYIPADAVETIKAKANFDPARVL
EIEQEVRHDVIAFLTNVNEYVGDAGRYIHLGMTSSDVLDTGLALQMVASVDLLLAETENL
IQAIRWQAQQHRETVMIGRSHGIHAEPITFGFKLAGWLAEMLRNRDRLVQVRQSVAVGKI
SGAVGTYANIEPRVEALTCQKLGLEPDTASTQVVSRDRHAEYVQVLALVAASLERFSVEI
RNLQRSDVLEVEEFFAKGQKGSSAMPHKRNPIRSERISGLARVIRGYAVAALENVALWHE
RDISHSSVERMMLPDCSATLHFMLVEMTELVKTLQVYPENMTRNLNRYGGVVFSQRVLLA
LVDKGLSREEAYRIVQSNAHSAWNHEGGNFRALIEADPTVQAHLSAAEIEDCFAAQHHLR
HLDDVYQRLNI
Download sequence
Identical sequences Q31RH2
WP_011377532.1.45845 WP_011377532.1.95485 1140.Synpcc7942_0315 gi|81299126|ref|YP_399334.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]