SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81299252|ref|YP_399460.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299252|ref|YP_399460.1|
Domain Number 1 Region: 51-215
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 8.89e-67
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.00000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81299252|ref|YP_399460.1|
Sequence length 222
Comment phosphoribosylaminoimidazole carboxylase, catalytic subunit [Synechococcus elongatus PCC 7942]
Sequence
MRIFVSRVGAAVIIGLHVTADPATQADRPNLTSVTMSSPVPAAPSALTQPAVGIIMGSDS
DLPTMRGAIAICQQFGIAHEVEIVSAHRTPVRMVEYAQTAHQRSLKVIIAGAGGAAHLPG
MVAALTPLPVIGVPVQTRTLQGVDSLYSIVQMPAGIPVATVAIGNATNAGLLAVQMLASH
NPELLQAVQTYRQELAQMVQDKQTRLSAIGVEAYLENAGGHH
Download sequence
Identical sequences A0A0H3K221 Q8GMR3
WP_011243388.1.45845 WP_011243388.1.5740 WP_011243388.1.95485 gi|81299252|ref|YP_399460.1| gi|56751086|ref|YP_171787.1| 1140.Synpcc7942_0441 269084.syc1077_c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]