SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81299303|ref|YP_399511.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299303|ref|YP_399511.1|
Domain Number 1 Region: 171-309
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 2.18e-41
Family ATP-dependent riboflavin kinase-like 0.00018
Further Details:      
 
Domain Number 2 Region: 14-174
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.16e-29
Family Adenylyltransferase 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|81299303|ref|YP_399511.1|
Sequence length 315
Comment bifunctional riboflavin kinase/FMN adenylyltransferase [Synechococcus elongatus PCC 7942]
Sequence
MRILDDLDPVSGPTAIALGNFDGIHLGHQQVIAPVRAAHRSHPDWMPSVVTFNPHPQAFF
SGDRLPSITPVAEKAELLQGLGIEQLVLLPFTRELANLTPEQFVSEVLVQHLQARQISVG
QDFRFGRGRSGSAQDLQAIAQGRGIPTTIVPLFKHRDLRVSSSAIRKALDQGQPELAAAW
LGRPYRLTGCVILGQQLGRQLGTPTANLQLPADKLLPRWGVYAGRAHLPEQGLHNLPAVL
NVGQRPTVTGDRSVSVEVHLLDWQGDCYGQLLQVDLLHFLRPEQKFDSLSALTQQIQQDC
RLARSQLATESSSLA
Download sequence
Identical sequences A0A0H3K1Y1 Q31QZ5
WP_011243340.1.45845 WP_011243340.1.5740 WP_011243340.1.95485 gi|81299303|ref|YP_399511.1| gi|56751037|ref|YP_171738.1| 1140.Synpcc7942_0492 269084.syc1028_d

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]