SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81299309|ref|YP_399517.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299309|ref|YP_399517.1|
Domain Number 1 Region: 1-279
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 2.92e-68
Family Cytidylytransferase 0.02
Further Details:      
 
Domain Number 2 Region: 241-428
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 8.18e-28
Family gamma-carbonic anhydrase-like 0.046
Further Details:      
 
Domain Number 3 Region: 380-518
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.12e-21
Family Phosphoglucomutase, first 3 domains 0.0045
Further Details:      
 
Domain Number 4 Region: 635-742
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.18e-16
Family Phosphoglucomutase, first 3 domains 0.0082
Further Details:      
 
Domain Number 5 Region: 532-631
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 0.00000000192
Family Phosphoglucomutase, first 3 domains 0.003
Further Details:      
 
Domain Number 6 Region: 748-831
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 0.000000837
Family Phosphoglucomutase, C-terminal domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81299309|ref|YP_399517.1|
Sequence length 837
Comment mannose-1-phosphate guanylyltransferase [Synechococcus elongatus PCC 7942]
Sequence
MRAVLLAGGLGTRLRPLTCDRPKPMVPILNRPIAAHILQLLHRHGYQEILATLYYRPETI
QQYFQEGQDWGVDLRYILEADRPLGTAGSVKNLTSQLQETFLVASGDCLSDFDLTAALAW
HRQQQAIATVILARVDQPLEFGCVVCDRQQRIIRLIEKPDASELISDTVNSGFYILEPEA
LDYLPLDEPSDFATHLLPRLLAAGEVVTGYVDQGYWCDIGNRQAYQRAQLDALLGRVRLQ
ANQMEWRPGIYVGEGTTIASSAQLEPPLWIGQHCYIGEEVQLKAGTVIGDESRIEAGACL
DRAVVWNRVQIGQRSHLEGCVLADGVRLERHVQIHEGAVIGSGCRLQEEAQVQAEVRIWP
RKQIEAGAIVNLNLIWATSARRRLFSDGGVRGIANVDITPEFAVKLGVAYGSTIPPGSSV
TVSRDQRSISQMVTRSLIAGLMSTGITIRNLEAAAVPIARSMLARLPVVGGIHVRLDPLW
PTHVLIEFLDREGLTVDRALERRIEAAFFQEDLRRVPMQDLGTMITVSETLPLYRQLFCD
RLDRDLLLRSPNRIVIDYAYSVSGAVLPLLLSEFGCDAVILNASLRQQPPTENERQSLLE
QMGQVVSAIKANCGVQVAANGERFTLVDEQGMALDHEQLTVLMAEICWLRRPGGTVVVPM
TSSSAVDQTAWRYHGRVHRCRPTPTALMAACRNLPDVILGGSGELGFIFPEMHAGFDAIF
GIARLIEGLDRQSRSLSQWVESLPSIAHRHLTLSCPRNLLGTLMRQLLESHEPDRLNFQE
GLRIQGDRGDQWLLVLPDASYPLIHLYANAQDHQWVEQTLGSYQQQIEQFVATLQSP
Download sequence
Identical sequences A0A0H3K880 Q31QY9
gi|56751031|ref|YP_171732.1| SnR140 gi|81299309|ref|YP_399517.1| 1140.Synpcc7942_0498 269084.syc1022_c WP_011243334.1.45845 WP_011243334.1.5740 WP_011243334.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]