SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81299406|ref|YP_399614.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|81299406|ref|YP_399614.1|
Domain Number - Region: 53-151
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 0.00119
Family Leukotriene A4 hydrolase N-terminal domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81299406|ref|YP_399614.1|
Sequence length 182
Comment hypothetical protein Synpcc7942_0595 [Synechococcus elongatus PCC 7942]
Sequence
MRRFSLLLAACLSFAAVPSEAVILRGRTFFDRPPRLVKMVTFFQIVNQYSPEYYLVLNLL
PDSGEPLGSVTLQQTEGVDRFFQFRLDATRAYVGEPRNFGKEIPVAETTFDNSQRLLSVR
FAQPVAPGQQITIVVRPQLNPDTAGTYLWGITAYPAGEQPAGQFLGFGRINIYDSSTYRT
SR
Download sequence
Identical sequences Q31QP2
gi|81299406|ref|YP_399614.1| 1140.Synpcc7942_0595 WP_011377637.1.45845 WP_011377637.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]