SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81299444|ref|YP_399652.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299444|ref|YP_399652.1|
Domain Number 1 Region: 12-227
Classification Level Classification E-value
Superfamily Ribosomal protein L1 1.22e-76
Family Ribosomal protein L1 0.000000714
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81299444|ref|YP_399652.1|
Sequence length 237
Comment 50S ribosomal protein L1 [Synechococcus elongatus PCC 7942]
Sequence
MTRKVSRRLQELQKKVEDRAYEPLAALNLLKETATAKFPESAEAHIRLGIDPKYTDQQLR
TTVALPKGTGQTIRVAVIARGEKVAEAKAAGADIAGSEELIEEISKGFLDFDLLIATPDV
MPQVAKLGRQLGPRGLMPSPKGGTVTFDLEQAINEFKAGKLEFRADRTGIVHVLFGKASF
SADDLLANLKALQETIDRNRPSGAKGRYWRSVYISATMGPAIEVDINALRDLKLAEA
Download sequence
Identical sequences Q31QK4
1140.Synpcc7942_0633 WP_011377655.1.45845 WP_011377655.1.95485 gi|81299444|ref|YP_399652.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]