SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81299522|ref|YP_399730.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299522|ref|YP_399730.1|
Domain Number 1 Region: 128-401
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 3.18e-105
Family BC ATP-binding domain-like 0.0000000121
Further Details:      
 
Domain Number 2 Region: 696-957
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.77e-104
Family BC ATP-binding domain-like 0.000000121
Further Details:      
 
Domain Number 3 Region: 396-549
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 3.01e-51
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.00014
Further Details:      
 
Domain Number 4 Region: 1-127
Classification Level Classification E-value
Superfamily PreATP-grasp domain 9.64e-50
Family BC N-terminal domain-like 0.00000215
Further Details:      
 
Domain Number 5 Region: 571-698
Classification Level Classification E-value
Superfamily PreATP-grasp domain 2.59e-46
Family BC N-terminal domain-like 0.00000234
Further Details:      
 
Domain Number 6 Region: 961-1095
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 2.75e-39
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81299522|ref|YP_399730.1|
Sequence length 1097
Comment carbamoyl phosphate synthase large subunit [Synechococcus elongatus PCC 7942]
Sequence
MPRRQDIRKILLLGSGPIVIGQACEFDYSGTQACKALREEGYEVVLVNSNPATIMTDPET
ADRTYIEPLTPELVAQVIERERPDALLPTMGGQTALNLAVALAKNGTLDRFGVELIGAKL
EAIEKAEDRLLFKEAMERIGVKVCPSGIANNMAEAQAIAEQIGTYPLIIRPAFTMGGTGG
GIAYNQEEFELIVQSGLDASPVSQILVEQSLIGWKEFELEVMRDLADNVVIICSIENLDP
MGVHTGDSITVAPAQTLTDKEYQRLRDQAIAIIREIGVETGGSNIQFAINPQDGDVIVIE
MNPRVSRSSALASKATGFPIAKIAAKLAVGYSLDELKNDITRQTPASFEPTIDYVVTKIP
RFAFEKFPGTPAQLTTMMKSVGEAMAIGRTFPESFQKALRSLEIGRSGWGCDRPETLPTL
EQIKPQLRTPSPDRIFAVRQAMLLGLSDGDIYQLTGIDPWFLEKFREILEGEDFLKRASI
EQITPAQWLEVKQLGFSDRQIAFALGSSEEAVRQRRQQQGIKPVYKLVDTCAAEFEAYTP
YYYSCYESPRSHLAESGLTTIPAESEVRPSDRPKVMILGGGPNRIGQGIEFDYCCCHAAF
ALAADGYETIMVNSNPETVSTDYDTSDRLYFEPLTREDVLNILEAERPQGVIIQFGGQTP
LKLAVPLQTFLQTPEGQALGTQIWGTSPDSIDTAEDRERFEQILRQLDIAQPANGLARSP
EEALAIAHRIGYPTVVRPSYVLGGRAMEIVYSDAELERYMTEAVQVEPDHPILIDKFLEN
AIEVDVDALADRTGQVVIGGIMEHIEQAGIHSGDSACSLPTVSLNETVLETIRAWTTQLA
KALNVIGLMNIQFAVKDEQVYILEANPRASRTVPFVSKAIGRPLAKIAARLMSGQTLADL
GITSELVPSYLSVKEAVLPFDRFPGTDTLLGPEMRSTGEVMGIDVDFGRAFAKAELAASQ
RLPRQGTVFISVSDRDKAAIGPIAREFLQLGFRVVATGGTQKVLAEQRLSVEPILKVHEG
RPHVLDALKNDQIQLIINTPAGARAKVDDQIIRRAALDYKVPTVTTIAGAKATVEAIRAL
LEQPLQVKSLQDYQQQG
Download sequence
Identical sequences A0A0H3K169 Q31QC6
gi|81299522|ref|YP_399730.1| WP_011243131.1.45845 WP_011243131.1.5740 WP_011243131.1.95485 1140.Synpcc7942_0711 269084.syc0819_c gi|56750828|ref|YP_171529.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]