SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|81299550|ref|YP_399758.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299550|ref|YP_399758.1|
Domain Number 1 Region: 10-108
Classification Level Classification E-value
Superfamily gpW/gp25-like 7.72e-27
Family gpW/gp25-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81299550|ref|YP_399758.1|
Sequence length 114
Comment hypothetical protein Synpcc7942_0739 [Synechococcus elongatus PCC 7942]
Sequence
MTRGMSRDSGKELKGIDHLRQSITDILTTPVGTRVWRRDYGSRLPRLVDRPINQSLIVDL
VAATAEALDRWEPRLKLEKVRIVSASAAGQVELNLIGYYIPEGRRITLEGLVVS
Download sequence
Identical sequences A0A0H3K195 Q31Q98
WP_011243104.1.45845 WP_011243104.1.5740 WP_011243104.1.95485 1140.Synpcc7942_0739 269084.syc0792_c gi|81299550|ref|YP_399758.1| gi|56750801|ref|YP_171502.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]