SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81299578|ref|YP_399786.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|81299578|ref|YP_399786.1|
Domain Number - Region: 113-143
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.000122
Family Rho termination factor, N-terminal domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|81299578|ref|YP_399786.1|
Sequence length 144
Comment hypothetical protein Synpcc7942_0767 [Synechococcus elongatus PCC 7942]
Sequence
MKNTFTHTAGLAQLMLMLACAVIAEYAPVAGRHLGRWAGRTIVAGRIARRWYNTHLAHRV
AIAEYGFRRFVAEQLGEEAPALRAAIEPWALTVYMVQTHTAAVDANIPTVCASMTIRELK
AIAQQRQIPNWSRMRKADLLAALS
Download sequence
Identical sequences Q31Q70
1140.Synpcc7942_0767 gi|81299578|ref|YP_399786.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]