SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81299650|ref|YP_399858.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299650|ref|YP_399858.1|
Domain Number 1 Region: 33-145
Classification Level Classification E-value
Superfamily DsrEFH-like 0.0000000000255
Family DsrH-like 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81299650|ref|YP_399858.1|
Sequence length 160
Comment hypothetical protein Synpcc7942_0840 [Synechococcus elongatus PCC 7942]
Sequence
MPEVTKPANQPGDFLVDYEEKVFPDVKAEPGEKALITFHTVAFEGSIGLVNLLQASRLIN
KGFETSILLYGPGVTLGVQRGFPKLGDAAFDGHLNFNARIQKFLDQGGKVYACRFALQAL
YGHGEGALIPGIRPINPLDVMDLILMHRKEGAFILDTWTL
Download sequence
Identical sequences Q31PZ8
gi|81299650|ref|YP_399858.1| 1140.Synpcc7942_0840 WP_011377758.1.45845 WP_011377758.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]