SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81299672|ref|YP_399880.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299672|ref|YP_399880.1|
Domain Number 1 Region: 242-357
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 1.7e-32
Family DRTGG domain 0.00027
Further Details:      
 
Domain Number 2 Region: 33-253
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.47e-29
Family Nitrogenase iron protein-like 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81299672|ref|YP_399880.1|
Sequence length 393
Comment hypothetical protein Synpcc7942_0863 [Synechococcus elongatus PCC 7942]
Sequence
MAEYWGGFKTPLKWSDIRHENDPGGKVLPSSPYLLLGSTEAYSGKSALTLGIAQYFQQQG
LRIAYGKPLGTCFEDSSVKPGAVLIDEDVRFIAETLNLSEDQRYPTLVMLDPTSVQRRLA
QTDSTDYLTQLQQYRDRPPGDIALIEGAGRLVDGQVFSLDLPAVAAALDAPVLLANRWSE
TGSVDSLLAAQQSLGDRLLGVVLNAVPRSELDHVRETLVPFLEARGIPVLGLLPQSALLR
SVSVTELVSRLNAEVLCCRDRLDLMVESLTIGAMNVNSAMEYFRKGRNMAVVTGGDRADI
QLAALETSTQCLILTGRVAPLPQIISRAEEMEIPILSVQLDTLTTVEIIDQAFGQVRLHE
VVKAQYVSRLVREALDFPRLQSLLGLPAIAAAS
Download sequence
Identical sequences A0A0H3K1G5 Q31PX6
gi|56750686|ref|YP_171387.1| WP_011242989.1.45845 WP_011242989.1.5740 WP_011242989.1.95485 gi|81299672|ref|YP_399880.1| 1140.Synpcc7942_0863 269084.syc0677_c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]