SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81299734|ref|YP_399942.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299734|ref|YP_399942.1|
Domain Number 1 Region: 104-319
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.56e-58
Family BC ATP-binding domain-like 0.00000277
Further Details:      
 
Domain Number 2 Region: 1-102
Classification Level Classification E-value
Superfamily PreATP-grasp domain 4.75e-34
Family BC N-terminal domain-like 0.0000552
Further Details:      
 
Domain Number 3 Region: 329-421
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 7.46e-28
Family BC C-terminal domain-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|81299734|ref|YP_399942.1|
Sequence length 433
Comment phosphoribosylamine--glycine ligase [Synechococcus elongatus PCC 7942]
Sequence
MKILVVGNGGREHALVWKLAQSPTVEAIVCVPGNGGTAGAAKCRNHALNALDGEALADLC
AREGLGLAVIGPEAPLAAGVADFLRDRGIAVFGPSQAGAQIEASKAWAKALMAEANIPTA
TAAVFTNAAAALDYVCQQGAPIVVKADGLAAGKGVVVAQTLAEAEAAIVASFEGAFGAAG
QTVVIEECLTGPEISVLAFTDGQTIRPLKVAQDHKRIGEGDTGLNTGGMGAYAPAPLATP
ELLAQVQAQVLEPALATLRDRGIDYRGILYAGLMLTPAGPKVIEFNCRFGDPETQSVLPL
LATPLVDVLLACAEGRLADLPELEWHDAVSACVVLAAGGYPGDYAKGDRIDGLAAAEAAG
AVVFHAGTNAVDDEIQTAGGRVLNVVATAADFDAAFTKVYQALESIQFRDRYYRRDVGWQ
VRSSGAAATTHES
Download sequence
Identical sequences A0A0H3K0K0 Q31PR4
NYSGRC-FDAO-ABB56955 WP_011242929.1.45845 WP_011242929.1.5740 WP_011242929.1.95485 gi|56750626|ref|YP_171327.1| gi|81299734|ref|YP_399942.1| 1140.Synpcc7942_0925 269084.syc0617_d

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]