SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81299736|ref|YP_399944.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299736|ref|YP_399944.1|
Domain Number 1 Region: 4-237
Classification Level Classification E-value
Superfamily SAICAR synthase-like 7.52e-79
Family SAICAR synthase 0.00000599
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|81299736|ref|YP_399944.1|
Sequence length 241
Comment phosphoribosylaminoimidazole-succinocarboxamide synthase [Synechococcus elongatus PCC 7942]
Sequence
MSAPLYEGKAKIVYATDDPQVYRTYFKDDATAFNAQKRGQISGKGAINCAVSSYLFRVLA
QAGVTNHFIEQISEREMRVQAVEIVPLEVVVRNLAAGSLCKQTGIAEGTAIAPPLVEFYL
KDDALGDPLLTPDRLRLLQVATEAEVQHLQGAALQVNTLLQAFFNRCGITLVDFKLEFGR
DRQGQILLADEISPDTCRLWDQQETDPEKRILDKDRFRRDLGNVEAAYARVLELVTQQAE
L
Download sequence
Identical sequences Q31PR2
gi|81299736|ref|YP_399944.1| WP_011377791.1.45845 WP_011377791.1.95485 1140.Synpcc7942_0927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]