SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81299760|ref|YP_399968.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299760|ref|YP_399968.1|
Domain Number 1 Region: 111-281
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 1.65e-58
Family NadC C-terminal domain-like 0.0000104
Further Details:      
 
Domain Number 2 Region: 3-110
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 1.53e-27
Family NadC N-terminal domain-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81299760|ref|YP_399968.1|
Sequence length 282
Comment nicotinate-nucleotide pyrophosphorylase [Synechococcus elongatus PCC 7942]
Sequence
MLPPWILLDPILSDWLREDLGRGDHSAQGLGLEGTTGKATWVAKSEGIIAGLPIAFRMLQ
LLDPQVKCTAKLAEGFACGSGQVIAELEGPLASLLSGERAALNVAMRLSGVATATRRFVD
QLADLPTQFVDTRKTTPGLRLLEKYATRVGGGTNHRLGLDDAVMVKDNHIAAAGGSIAAA
IKKLRSQLPFPLIIEVETETLGQVMEAISAGVGVIMLDNMNLAQVQAAVQVIRDRAPRTK
IEVSGNISLENIRAIAETGVDYISSSAPITRSPWLDISMRLQ
Download sequence
Identical sequences Q31PN8
gi|81299760|ref|YP_399968.1| 1140.Synpcc7942_0951 WP_011377803.1.45845 WP_011377803.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]