SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81299763|ref|YP_399971.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299763|ref|YP_399971.1|
Domain Number 1 Region: 20-255
Classification Level Classification E-value
Superfamily Folate-binding domain 3.45e-51
Family Aminomethyltransferase folate-binding domain 0.0018
Further Details:      
 
Weak hits

Sequence:  gi|81299763|ref|YP_399971.1|
Domain Number - Region: 273-334
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.00283
Family Aminomethyltransferase beta-barrel domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81299763|ref|YP_399971.1|
Sequence length 344
Comment glycine cleavage T-protein-like protein [Synechococcus elongatus PCC 7942]
Sequence
MSQKPSAIAEDRTCCAQPCFVTESVLLFEPSLWSVIQVSDRDRLTFLHNQSTQSFWQRQP
GEACETVLVTATARILDLAIAVIDVEAVWLLVSPSRQADLLQRLDRYIFFSDQVTVADAD
STLAVLTLIGDSTRSLLQTVVADALPELTENQHAALAIAGQSVQWVNYSGLGLPGSLLLV
PVSGLDAVQAALQAAGAQLATVEQWERLRIQQGRPAVDRELTEEYNPLEAGLWQTLSFDK
GCYIGQETIARLNTYKGVKQRLYGLALTTLPSQLPAPLLLEGEKVGVLTSAIATATGAIG
LGYLRTKAGGAGLTVDCEGQPAMVVDRPYLRHTYFEPESASAAR
Download sequence
Identical sequences A0A0H3K173 Q31PN5
gi|81299763|ref|YP_399971.1| gi|56750597|ref|YP_171298.1| 1140.Synpcc7942_0954 269084.syc0588_d WP_011242900.1.45845 WP_011242900.1.5740 WP_011242900.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]