SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81299767|ref|YP_399975.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299767|ref|YP_399975.1|
Domain Number 1 Region: 21-205
Classification Level Classification E-value
Superfamily Formyltransferase 2.22e-57
Family Formyltransferase 0.0000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81299767|ref|YP_399975.1|
Sequence length 209
Comment phosphoribosylglycinamide formyltransferase [Synechococcus elongatus PCC 7942]
Sequence
MSSLTVPDRFPTESSTAIALGVLASGNGSNFEALAQAITADQLQAEIRLLIYNNPDAYVR
QRAERLGIPALLLDHRQFASREDLDQAIITAFRNRGVEWIAMAGWMRLVTETLIQAFPER
IINIHPSLLPSFKGIRAVEQAIAAKVRISGCTAHLVTLDVDSGPILVQAAVPVLPDDTVD
SLQQRIQVEEHKILPLAIALAAARSPLPV
Download sequence
Identical sequences A0A0H3K6M0 Q31PN1
WP_011242896.1.45845 WP_011242896.1.5740 WP_011242896.1.95485 gi|81299767|ref|YP_399975.1| 1140.Synpcc7942_0958 269084.syc0584_d gi|56750593|ref|YP_171294.1| NYSGRC-FDAO-ABB56988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]