SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81299829|ref|YP_400037.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299829|ref|YP_400037.1|
Domain Number 1 Region: 119-304
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 7.37e-34
Family D-glucarate dehydratase-like 0.0021
Further Details:      
 
Domain Number 2 Region: 4-94
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.24e-18
Family Enolase N-terminal domain-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81299829|ref|YP_400037.1|
Sequence length 316
Comment O-succinylbenzoate synthase [Synechococcus elongatus PCC 7942]
Sequence
MSFRFAFRPYQRRLRQPLRTARDAQITVRLGIWLRLETDTEVRWGEIAPWPSFGSETLAE
AIAFCEAFPPDPEWEDLATAPDSLPACQFGFGCLRESNATDFLPTSAVLLPAGAAALTAI
ATASPATTYKWKIGLDLESELDLLPQLDRLLPSAAKLRLDANGGLTKAQADRLLQVLTAI
NERRSGRIEWLEQPLDPSQVDDLLQLVQDWPLVAIALDESVSQLSSLQFWQAQGWPGLYV
LKPAIAGWPQTVRQFCQVHHLPVVVSSMFESPIGWRAVAAIAAQLGRADQAQGLGTTAWF
TDDWESKTAAALWQHP
Download sequence
Identical sequences A0A0H3K6E2 Q31PG9
1140.Synpcc7942_1020 269084.syc0526_c NYSGXRC-9419a WP_011242838.1.45845 WP_011242838.1.5740 WP_011242838.1.95485 gi|56750535|ref|YP_171236.1| gi|81299829|ref|YP_400037.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]