SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81299846|ref|YP_400054.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299846|ref|YP_400054.1|
Domain Number 1 Region: 81-360
Classification Level Classification E-value
Superfamily PLP-binding barrel 4.3e-67
Family Alanine racemase-like, N-terminal domain 0.0018
Further Details:      
 
Domain Number 2 Region: 469-573
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.00000122
Family Eukaryotic ODC-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81299846|ref|YP_400054.1|
Sequence length 647
Comment arginine decarboxylase [Synechococcus elongatus PCC 7942]
Sequence
MAAEQTAIAPLAVAVESQQWRIEDSEALYRIQGWGEPYFGINAAGHITVSPQGDRGGSLD
LYELVEALRRRGLNLPLLIRFPDILEDRIERLNACFAKAIARYNYAGEYRGVFPVKCNQQ
RHLIESLVNYGRPFQFGLEAGSKPELLIALAHLDTPGALLICNGYKDRDYIETAILGRRL
GKTPILVIEQLEEVDVAIAASQRLGIEPILGVRAKLNARGMGRWGSSAGDRAKFGLTMPE
IVAAVEKLQAANLLHCLQLLHFHIGSQISDISVLKDAIQEAAQIYVQLAALGADMRYLDV
GGGLGVDYDGSKTNFHASKNYNMQTYANDVVATIKDACQAHRLAVPTLTSESGRAIASHQ
SVLVFDVLGSSEVPRAAVEPPQEEDSAIVRTLYEVLEAIALENLQECYHDAFKLKEDAVS
AFRLGYLSLTERAKAERLFWSCCHRIQEFLKQLDRIPEDLEDLERVMASIYYVNLSVFQS
APDTWAIDQLFPIMPIHRLNEEPNQRVTLADLTCDSDGKIDRFIDLLDVKSTLELHSLQP
DQPYVLGMFLGGAYQEIMGNLHNLFGDTNAVHIKLTPKGYSIEHVVKGDTMGEVLGYVQY
DTEQLLERLRQQTEAALQQDQISLDEAQRLLRHYEEGLQRYTYLSLD
Download sequence
Identical sequences Q31PF2
gi|81299846|ref|YP_400054.1| NYSGRC-FDAO-ABB57067 1140.Synpcc7942_1037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]