SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|81299894|ref|YP_400102.1| from Synechococcus elongatus PCC 7942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|81299894|ref|YP_400102.1|
Domain Number 1 Region: 189-649
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.68e-119
Family Amylase, catalytic domain 0.00000000409
Further Details:      
 
Domain Number 2 Region: 657-759
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 9.71e-37
Family alpha-Amylases, C-terminal beta-sheet domain 0.00027
Further Details:      
 
Domain Number 3 Region: 23-124
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000056
Family E-set domains of sugar-utilizing enzymes 0.0079
Further Details:      
 
Domain Number 4 Region: 149-206
Classification Level Classification E-value
Superfamily E set domains 0.0000000364
Family E-set domains of sugar-utilizing enzymes 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|81299894|ref|YP_400102.1|
Sequence length 774
Comment glycogen branching enzyme [Synechococcus elongatus PCC 7942]
Sequence
MTGTTPLPSSSLSVEQVNRIASNQEQNPFDILGPHPYEHEGQAGWVIRAYLPEAQEAAVI
CPALRREFAMHPVHHPHFFETWVPEETLEIYQLRITEGERERIIYDPYAFRSPLLTDYDI
HLFAEGNHHRIYEKLGAHPCELENVAGVNFAVWAPSARNVSILGDFNSWDGRKHQMARRS
NGIWELFIPELTVGAAYKYEIKNYDGHIYEKSDPYGFQQEVRPKTASIVADLDRYTWGDA
DWLERRRHQEPLRQPISVYEVHLGSWMHASSDAIATDAQGKPLPPVPVADLKPGARFLTY
RELADRLIPYVLDLGYSHIELLPIAEHPFDGSWGYQVTGYYAATSRYGSPEDFMYFVDRC
HQNGIGVILDWVPGHFPKDGHGLAFFDGTHLYEHADSRQGEHREWGTLVFNYGRHEVRNF
LAANALFWFDKYHIDGIRVDAVASMLYLDYNRKEGEWIPNEYGGRENIEAADFLRQVNHL
IFSYFPGALSIAEESTSWPMVSWPTYVGGLGFNLKWNMGWMHDMLDYFSMDPWFRQFHQN
NVTFSIWYAFSENFMLALSHDEVVHGKSNLIGKMPGDEWQKFANLRCLLGYMFTHPGKKT
LFMGMEFGQWAEWNVWGDLEWHLLQYEPHQGLKQFVKDLNHLYRNAPALYSEDCNQAGFE
WIDCSDNRHSIVSFIRRAHESDRFLVVVCNFTPQPHAHYRIGVPVAGFYREIFNSDARSY
GGSNMGNLGGKWTDEWSCHNRPYSLDLCLPPLTTLVLELASGPESLSEAANSPL
Download sequence
Identical sequences P16954 Q5N4W5
gi|81299894|ref|YP_400102.1| NYSGRC-FDAO-ABB57115 gi|56750473|ref|YP_171174.1| 1140.Synpcc7942_1085 269084.syc0464_c WP_011242776.1.45845 WP_011242776.1.5740 WP_011242776.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]